KEGG   Panthera tigris altaica (Amur tiger): 102960528
Entry
102960528         CDS       T02988                                 

Gene name
KNG1
Definition
(RefSeq) kininogen 1
  KO
K03898  kininogen
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04022  cGMP-PKG signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04080  Neuroactive ligand-receptor interaction
ptg04610  Complement and coagulation cascades
ptg04750  Inflammatory mediator regulation of TRP channels
ptg04810  Regulation of actin cytoskeleton
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    102960528 (KNG1)
   04022 cGMP-PKG signaling pathway
    102960528 (KNG1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102960528 (KNG1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102960528 (KNG1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    102960528 (KNG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    102960528 (KNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102960528 (KNG1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102960528 (KNG1)
   05143 African trypanosomiasis
    102960528 (KNG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102960528 (KNG1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102960528 (KNG1)
Peptidases and inhibitors [BR:ptg01002]
 Peptidase inhibitors
  Family I25: cystatin family
   102960528 (KNG1)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   102960528 (KNG1)
  Exosomal proteins of other cancer cells
   102960528 (KNG1)
SSDB
Motif
Pfam: Cystatin Cathelicidins Spp-24
Other DBs
NCBI-GeneID: 102960528
NCBI-ProteinID: XP_007083653
LinkDB
Position
Un
AA seq 674 aa
MKLIAVLFLCSRLLPSLTEESFSQDIDCNDEDLFKAVDTALKKYNSRNQSGNQFVLYRVT
EVTRTDDPETFYSFKYQIREGDCSVQSDKTWQDCDYKESAQAATGECSATVGKRGNTKFS
VATQTCQITPAEGPVVTSQYDCLGCVHPISTASLDLEPVLRHAIQHFNNHTGRSHLFALR
EVKRAHRQVVAGWNYEITYSIVQTNCSKEHFLFLTPDCKSLLNGDIGECTDHAHVDLQLR
IASLSQKCELYPGEDFIEPPPSICPGCPKEIPVNSPELEVALNHSTAKLNAENNGTFYFK
IDHVKSATVQVVAGKKFSIEFTARETTCSKESNEELTESCNTNKFGKILDCKAEVYVIPW
EKKIYPTVHCQSRGETTLMKRPPGFSPFRSVQVEKTKEGTTVSPPHTSMASVQDEEQDSG
KEQGPTRGHGWGHGKQIKHGFGHGHKHEHDQGHRHNRGRGLGHGHQKQHGFAHGHQKQHG
FGHGHQQQHGLGHGHQQELDYDLEHQGRHGLGHGHQRGRGLAHGHTHEHGHGHGKYKNKR
KDNEKDNGWRIEHLASSSEDSTTSSAQTQEKTEGPTPLPPLAQPGIAVTLPDFQDSDLIA
AVMSNTPPTPTEIDDDWIPDIQIEKNSLSFNLIPDFPEKTSPKCPGRPWKPVNGMNPTVE
IKEFHDFDLSDALY
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgaaattaattgctgtgcttttcctttgctctaggctgctaccaagcttaaccgaggag
tccttctcacaagatatcgattgcaatgatgaagacctattcaaggctgtggacactgct
ctgaagaaatataacagtagaaaccaaagtggcaaccagtttgtgttgtaccgtgtaacc
gaggtcaccaggacggatgaccctgagacattttattccttcaagtaccaaatcagggag
ggagactgttctgttcaaagtgacaaaacatggcaggattgtgactacaaagaatctgca
caagctgccacaggagaatgctccgcaaccgtcgggaagagagggaatacaaaattctcc
gtggctacgcagacctgccagattactccagccgagggtcctgtggtgacaagccagtat
gactgccttggctgtgtgcaccccatatcgactgcgagccttgacctggagcccgttctc
agacacgccattcaacattttaacaaccacaccggtcgttcccacctctttgctcttaga
gaagtcaagagggcccacagacaggtggtggctggatggaattatgaaattacttactca
attgtgcagacgaattgctccaaggaacattttctgttcttaactccagactgcaagtcc
cttttgaatggtgatatcggtgaatgtacagatcacgcacacgtggatctgcagctaaga
attgcttctttgtcacagaagtgtgaactctatccaggagaggattttatagaaccgcct
cccagtatttgccctggctgtcccaaagagatacctgtcaacagcccagagctggaggtg
gctctgaatcattccactgcaaagcttaatgcagagaataatggaacgttctatttcaag
attgaccacgtgaaaagtgcaacagtacaggtggtggctggaaagaaattttctattgag
ttcacagccagggaaaccacgtgctccaaggaaagtaatgaagagttgacagaaagttgc
aataccaataaatttggaaaaattctagactgtaaagctgaagtttatgtgataccttgg
gagaagaaaatttaccctactgtccactgtcaatcacggggagagaccacattgatgaaa
aggcctccaggtttttcacctttccgatcagtacaagtggagaaaacaaaagaaggaaca
actgtaagtccaccccacacttccatggcatctgtacaagatgaagagcaggattcagga
aaagaacaaggacccactcgtgggcatggctggggtcatggaaagcaaataaaacatggc
tttggccatggccataaacatgagcatgaccaaggccataggcacaataggggacgtggc
cttggccatggacatcaaaaacaacatggctttgcccatggacatcaaaagcaacatggc
tttggccatggacatcaacagcaacatggccttggtcatggacatcaacaggaacttgac
tatgatcttgaacaccaagggagacatggccttggccatggacatcaaaggggacgtggc
ctagcccatggacatacccatgagcatggtcatggccatggaaaatataaaaataaaaga
aaagacaatgaaaaggacaatggttggagaatagagcatttggcaagttcttctgaagat
agtactacctcttctgcacagacacaagagaagacagaagggccaacacccctccctccc
ctagcccagccaggtatagcagttaccttgcctgactttcaggactcagatctcattgca
gctgtgatgtctaacacaccaccaactcccacagagattgatgatgattggatccctgac
atccagatagaaaaaaatagcctttcatttaacctgatacctgactttccagaaaaaacc
tcccccaaatgtcccggacgcccctggaagccagttaatggaatgaatccaactgtggaa
atcaaagaatttcatgattttgatctctctgatgctttgtattaa

DBGET integrated database retrieval system