KEGG   Panthera tigris altaica (Amur tiger): 102960613
Entry
102960613         CDS       T02988                                 

Gene name
TOP2B
Definition
(RefSeq) topoisomerase (DNA) II beta
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102960613 (TOP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptg03032]
    102960613 (TOP2B)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102960613 (TOP2B)
Enzymes [BR:ptg01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     102960613 (TOP2B)
DNA replication proteins [BR:ptg03032]
 Eukaryotic type
  DNA Topoisomerases
   102960613 (TOP2B)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    102960613 (TOP2B)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102960613 (TOP2B)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 102960613
NCBI-ProteinID: XP_007097556
LinkDB
Position
Un
AA seq 1620 aa
MVYAACLRRYRSTWCPIRHVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQLEH
ILLRPDTYIGSVEPLTQLMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRDKNM
TCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGR
NGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITFQPD
LSKFKMEKLDKDIVALMTRRAYDLAGSCKGVKVMFNGKKLPVNGFRSYVDLYVKDKLDET
GVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIEVVK
KKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFFKAA
SNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLILTEG
DSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSY
DDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKASK
NKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFRYAG
PEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFINKE
LILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHHGEQ
ALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSSLSRLLFPAVD
DNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRMLDG
LDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQVLEP
MLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNSMVL
FDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKIQGK
ITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEEETQNQHDDSSSDSGTPSGPDF
NYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVEAQE
REDILAGMAGKAIKGKVGKPKVKKLQLEETMPSPYGRRIVPEITAMKADASKKLLKRKKG
DLDTTAVKVEFDEEFGGTPVEGTGEEALIPSAPVNKGPKPKREKKEPGTRVRKTPTSSGK
STAKKVKKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDDDAD
DDEDNNDLEELKVKASPITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSSHDKKGQDF
GNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPSSDTT
AKPKRTPKQKKVETINSDSDSEFGIPKKSTPPKGKGRGAKKRKASGSENEGDYNPGRKTS
KTPSKKMKKTSFDQDSDVDIFPSDFTSEAPSLPRSGRARKEVKYFAESDDEEDVDFAMFN
NT seq 4863 nt   +upstreamnt  +downstreamnt
atggtctatgccgcctgtttacgccgataccgtagcacctggtgtcccatcaggcacgtg
actctttttgatcagaacaatgctgcaaaaaaagaagagtcagaaactgcaaacaaaaat
gattcttcaaagaagttgtctgttgagagagtgtatcagaaaaagacacaacttgaacat
attctccttcgtcctgatacgtatattgggtcagtggagccattgacacagctaatgtgg
gtatatgatgaagatgtaggaatgaattgcagagaggttacctttgtgccaggtttatac
aagatctttgatgaaattttggttaatgcagctgacaataaacagagggataagaatatg
acctgtattaaagtttctattgatcctgaatctaacattataagcatttggaataatggg
aaaggcattccagtagtagaacacaaagtagagaaagtttatgttcctgcattaattttt
ggacagcttttaacatccagtaactatgatgatgatgagaaaaaagtaacaggtggtcgc
aatggttatggtgcaaaactttgtaatattttcagtacaaagtttacagtagagactgct
tgcaaagaatacaagcatagttttaagcagacatggatgaataacatgatgaaaacttct
gaagccaaaattaaacattttgatggtgaagattacacatgcataacattccaaccagat
ctgtctaaatttaagatggaaaaacttgacaaggatattgtggccctcatgaccagaaga
gcttatgatttggctggttcatgcaaaggggtcaaggtcatgtttaatggaaagaaattg
cctgtaaatgggtttcgcagttacgtagatctttatgtgaaagacaaattggacgaaact
ggagtggccctgaaagttattcatgaacttgcaaatgaaagatgggatgtttgtctcaca
ctgagtgaaaagggattccagcaaatcagctttgtaaatagtattgcgacaacaaaaggt
ggacgtcatgtggattatgtagtagatcaagttgttggtaaactgattgaagtagttaag
aaaaagaacaaagctggggtatcagtaaaaccatttcaagtaaaaaaccatatatgggtt
tttattaattgccttatcgaaaatccaacttttgattctcagacgaaagaaaacatgact
ctgcagcccaaaagttttgggtccaaatgccaactgtcagaaaaattttttaaagcagcc
tctaactgtggcattgtagaaagtattctgaactgggtgaaatttaaggctcagactcag
ctgaacaagaagtgttcatcagtaaagtatagtaaaatcaaaggtattcccaagctggat
gatgctaatgatgctggtggcaaacattccctggagtgtacattgatactaacagaggga
gactctgccaaatcgctggctgtgtctggattaggtgtgatcgggcgagacagatacgga
gtctttccacttaggggaaaaattcttaacgtccgagaagcttcccataaacagatcatg
gaaaatgcagaaataaacaatattatcaaaatagttggtctacaatacaagaaaagttac
gatgatgcagaatctctgaaaactttacgctatgggaagattatgattatgactgatcag
gatcaagatggttctcacataaaaggcctgcttattaatttcatccatcacaattggcca
tcacttttgaagcatggttttcttgaagagttcattactcctattgtaaaggctagcaaa
aataagcaggaactttccttctatagtattcctgaatttgacgagtggaaaaaacatata
gaaaaccagaaagcctggaaaataaagtactacaaaggtttgggtaccagcacagctaaa
gaagcaaaagaatattttgctgatatggaaaggcaccgtatcttgtttagatatgctggc
cctgaagatgatgctgccattaccttggcattcagtaagaagaagattgatgacagaaaa
gaatggttaacaaattttatggaagatcggagacagcgtaggttacatggcttaccagag
caatttttgtatggtacagcaacaaagcatttgacttacaatgatttcatcaacaaagaa
ttgattctcttctcaaactcagacaatgaaagatctataccatctcttgttgatggcttt
aaaccaggccaacgtaaagttttatttacctgtttcaagaggaatgataaacgtgaagta
aaagttgcccagttggctggatctgttgctgagatgtctgcttatcatcatggagaacaa
gcactgatgatgactattgtgaatttggctcagaactttgtgggaagtaacaacattaac
ttgcttcagccaattggtcagtttggaactcggcttcatggtggcaaagatgctgcaagc
cctcgttatattttcacaatgttaagctctttatcaagactgctttttcctgctgtggat
gacaacctgcttaaattcctttatgatgataatcaacgtgtagagcctgagtggtatatt
cctataattcccatggttttaataaatggtgctgagggcattggcactggatgggcctgt
aaactacccaactatgatgctagggaaattgtgaacaatgtcagacgaatgctagatggc
ttggatcctcatcctatgcttccaaactacaaaaactttaaaggaacgatccaagagctt
ggccaaaaccaatatgcagtcagtggtgaaatatttgtggtggatagaaacacagtagag
attacagagcttccagttagaacttggacacaggtatacaaagaacaggttttggaacct
atgctaaatggaacagataaaacaccagcattaatttctgattataaagaatatcatact
gatacaactgtgaaatttgtggtgaaaatgactgaagagaagctagcacaagcagaagct
gctggattgcataaagtttttaaacttcaaactactcttacttgtaattccatggtactc
tttgatcatatgggatgtctcaagaagtatgaaactgtgcaagacattttgaaagaattc
tttgatttacgattaagttattacggtttacgtaaggagtggcttgtaggaatgttggga
gcagaatctacaaagcttaacaatcaagcccgtttcattttagagaagatacagggaaaa
attaccatagagaataggtcaaagaaagatttgattcaaatgttagtccagagaggttat
gaatctgacccagtgaaagcctggaaagaagcacaagaaaaggcagcagaagaggaagaa
acacaaaaccagcatgatgatagttcctctgattcaggaactccttcaggccccgatttt
aattatattttaaatatgtctctgtggtctcttactaaagaaaaagttgaagaactgatt
aaacagagagatgcaaaagggcgagaggtcaatgatcttaaaagaaaatctccttcagat
ctttggaaagaagatttagcagcatttgttgaggaactggataaagtggaggcgcaagaa
cgagaagatattctggctggaatggctgggaaagcaataaaaggtaaagttggcaaacct
aaggtgaagaaacttcagttggaagagacaatgccttccccttatgggagacgaatagtt
cctgaaattactgctatgaaggcagatgccagcaaaaagttgctgaagaggaaaaagggt
gatctcgataccacagcagtgaaagtagaatttgacgaagaattcggtggaacaccagta
gagggtacaggagaagaggcattgatcccgtcagctcctgtaaataaaggtcccaaaccc
aaaagggagaaaaaggagcctggtaccagggtgagaaaaacacctacatcatctggtaaa
tccactgcaaagaaagtgaagaaacggaatccttggtcagatgatgaatccaagtcagaa
agtgacttggaagaaacagagcctgtggttattcccagagattctttgcttaggagagca
gctgctgaaaggcctaaatacacgtttgacttctcagaagaggaggatgatgatgctgat
gatgatgaggacaataatgatttagaggaattgaaagtgaaagcatctcccataacaaat
gatggggaagatgaatttgttccctcagatggcctagataaagatgaatatacattttca
cctggcaaatcaaaagctactccagaaaaatcttcacatgacaaaaaaggtcaagatttt
gggaatctcttctcatttccttcatactctcagaagtcagaagatgattcagctaaattt
gacagtaatgaagaagattctgcctctgttttttcaccatcgtttggtctgaaacaaaca
gataaagttccaagtaaaacagtagctgctaaaaagggaaaaccatcttcagatacaact
gctaagcccaagagaacccctaaacagaagaaagtagagactataaactctgactcagat
tcagaatttggcattccaaagaagagtacacccccaaaaggtaaaggccgaggagcaaag
aaaaggaaagcatctggctctgaaaatgaaggcgattataaccctggcaggaaaacatcc
aaaacaccaagcaagaaaatgaagaaaacctcttttgatcaggattcagatgtggacatc
ttcccatcagatttcacttctgaagcaccttctctgccacggagcggtcgggctaggaaa
gaagtaaaatattttgcagagtccgatgacgaagaagatgttgattttgcaatgtttaat
taa

KEGG   Panthera tigris altaica (Amur tiger): 102970050
Entry
102970050         CDS       T02988                                 

Gene name
TOP2A
Definition
(RefSeq) topoisomerase (DNA) II alpha
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102970050 (TOP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ptg03032]
    102970050 (TOP2A)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102970050 (TOP2A)
Enzymes [BR:ptg01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     102970050 (TOP2A)
DNA replication proteins [BR:ptg03032]
 Eukaryotic type
  DNA Topoisomerases
   102970050 (TOP2A)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    102970050 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    102970050 (TOP2A)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 102970050
NCBI-ProteinID: XP_007085875
LinkDB
Position
Un
AA seq 1534 aa
MEVSPLQPVNENMLINKTKKNEDAKKRLSIERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDIGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIKVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKVDETGNPLKIIHEQVNPRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYIADQIVTKLVEVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQVKSFGSTCHLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSNECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTHFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDIREVVNNIRRLMDGEEPLPMLPSYKNFRGTIE
ELAPNQYVISGEVAILNSTTIEISELPIRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNENEAEKGDSVKDSGPTFNYLLDMPLWYLTKEK
KDELCKLRNEKEQELETLKRKSPSDLWKEDLAAFIEELEAVETKEKQEEQIGLPGKGGKA
KGKKIQMAEVLPSPCGKRVIPRVTIEMKAEAEKKIKKKIKSENTEGSPQEDGMELEGLKQ
RLEKKQKREPGTKTKKQTTLPFKPVKKGKKRNPWSDSESDMSSNESDFDVPPREIEPRRA
ATKTKFTVDLDSDDDFSDFDEKTQDEDFVPSDVSPVKTKTSPPVPTNKELKPQKSATSVM
DLDAGGAKDSVPPSLDSPAADFSAETEIINPVSKKKVAVKKTAAKSQSSTSTTGAKKRAA
PKGTKKEPGLNSDVSQKPDPPKTKNRRKRKPSTSDDSDSNFEKMISKTVTSKKSKGESED
FHLDLDSAVAPRAKSGRAKKPIKYLEESDEDDLF
NT seq 4605 nt   +upstreamnt  +downstreamnt
atggaggtgtcaccactgcagcctgtaaatgaaaatatgctaatcaacaaaacaaagaaa
aatgaagatgctaagaaaagactgtctattgaaaggatctatcaaaagaaaacccaactg
gaacatattttgctccgcccagacacctatattggctccgtggaattagtgacccagcaa
atgtgggtttacgatgaagatattggcattaactacagggaagtcacctttgtccctggg
ttgtacaaaatctttgatgagattctagtcaatgctgcagacaacaaacaaagggaccca
aaaatgtcttgtattaaagtcacaattgacccggaaaacaatttaattagtatatggaat
aatgggaaaggtattcctgttgttgaacacaaagttgagaagatgtatgtcccagctctc
atctttggacagctcctaacttctagtaactatgatgatgatgaaaagaaagtaacaggt
ggtcgaaatggctatggggccaaattgtgtaacatattcagtaccaaatttactgtggaa
acagccagtagagaatacaagaaaatgttcaaacagacgtggatggataacatgggaagg
gctggtgagatggaactcaagcccttcaatggggaagattatacatgtattaccttccag
cctgatttgtccaagtttaaaatgcaaagcctagacaaagatattgttgcactaatggtc
agaagagcatatgatattgccggatccactaaagatgtcaaagtgtttctcaatggaaat
aagctgccagtaaaaggattccgtagctatgtagatatgtatttgaaggataaggtagat
gaaactggcaatccgttgaaaattatccatgaacaagtaaaccccaggtgggaagtatgc
ttaacaatgagtgaaaaaggctttcagcaaattagctttgtcaacagcattgctacttcc
aagggtggcagacatgttgattatatagctgatcagattgtgactaaacttgttgaggtt
gttaaaaagaagaacaagggtggtgttgcagtaaaagcacatcaggtgaaaaatcacatg
tggatttttgtgaatgccttaattgaaaacccaacctttgattctcagacaaaagagaac
atgactttacaagtcaagagctttggatcaacctgccatttaagtgaaaaattcatcaaa
gctgcaattggttgtggtattgtagaaagcatactaaactgggtgaagtttaaggcccaa
gtacagttaaacaagaagtgttcagctgtaaaacataacaggatcaagggaattcccaaa
ctcgatgatgccaatgatgcagggggtcgaaattccaatgagtgtacacttatcctgact
gagggagactcagctaaaactttggctgtttcgggccttggcgtggttgggagagacaaa
tatggggttttcccgcttagaggaaaaatactcaatgttcgagaagcttctcataaacag
atcatggaaaatgctgaaattaacaatatcatcaagattgtgggtcttcagtacaagaaa
aactatgaagatgaagattcattgaagactcttcgttatgggaagataatgattatgaca
gatcaggaccaagatggttcccatatcaaaggcttgctgattaattttatccatcacaac
tggccctctcttctgcggcaccgttttctggaagaatttatcactcctattgtaaaggtg
tctaaaaacaagcaagaaatggcattctatagccttcctgaatttgaagaatggaagagt
tctacaccaaatcataaaaaatggaaagtcaagtactacaaaggtttgggcacgagcaca
tcaaaagaggctaaggaatactttgcagatatgaaaagacatcgtattcaattcaaatat
tccggtcctgaagatgatgctgccatcagcctggcctttagcaagaaacagatagatgat
cgaaaggaatggttaactcatttcatggaggacagaaggcaacggaagttacttggcctt
cctgaggattacttgtatggacaaactaccacatatctgacatataatgacttcataaac
aaggaacttatcctgttctcaaattctgataacgagagatctattccatctatggtggat
ggtttgaaaccaggtcaaagaaaggttttgtttacctgtttcaaacggaatgacaagcga
gaggtgaaggttgctcagttagctgggtcagtggcagagatgtcctcttatcatcatggt
gagatgtcactaatgatgaccattatcaatttggctcagaattttgtgggtagcaataat
ctgaacctcttgcaacccattggtcagtttggtaccaggctgcatggtggtaaggattct
gctagtcctcgatacatcttcacaatgctcagccctttggctcggttgttatttccacca
aaagatgatcatacattaaagtttttatatgatgacaatcaacgtgttgaacctgaatgg
tacattcctattatacccatggtgctgataaatggtgctgaaggaatcggtactgggtgg
tcctgcaaaatcccgaactttgatattcgtgaagttgtaaataatatcaggcgtctgatg
gatggagaagaacctttgccaatgcttccgagttacaagaacttcaggggtacgattgaa
gagctggctccaaatcaatatgtgattagtggtgaagtggctattcttaattccacaacc
attgaaatctcagaacttcccatcagaacatggacccaaacatataaagaacaggttcta
gaacccatgttgaatggcactgagaagacaccacctctcataaccgattatagggaatac
catacagacaccactgtgaagtttgttgtgaagatgactgaagagaaattggcagaggca
gagagagtgggactacacaaagtcttcaaactccagactagtctcacatgcaactctatg
gtgctttttgaccatgtaggatgtttaaagaaatatgacacagtgttggatattctaaga
gacttctttgaactcaggcttaagtattatggattaagaaaagaatggctactaggaatg
cttggtgctgaatctgctaaactgaacaatcaggctcgctttatcttagagaaaatagat
ggcaaaataatcattgaaaataagccaaagaaggaattaattaaagttctgattcagagg
ggttatgattctgatcctgtgaaggcttggaaagaagcccagcaaaaggtaccagatgaa
gaagaaaatgaagagagtgacaatgaaaatgaagccgaaaagggtgactctgtaaaagat
tctggaccaaccttcaactaccttcttgatatgcctctttggtatctcaccaaggaaaag
aaggatgaactgtgcaagctgagaaatgaaaaagaacaagagctagaaacattaaagaga
aagagtccatcagatttgtggaaagaagacctagctgcttttattgaagagctggaggct
gttgaaacaaaggaaaaacaagaagaacaaataggactccctgggaaaggggggaaagca
aaggggaaaaaaatacagatggctgaagttttgccttctccatgtgggaaaagagtcatc
ccccgagtgaccatagagatgaaagcagaggcagaaaagaaaattaaaaagaaaattaag
agtgaaaacactgaagggagccctcaagaggatggtatggaactagaaggtctgaaacaa
aggttggagaagaaacagaaaagagagccaggtaccaagacaaagaagcaaactacgttg
ccatttaaaccagtcaaaaaaggaaagaagagaaacccctggtctgattcagaatcagat
atgagcagtaatgaaagtgactttgatgttcccccacgagagatagagccacggagagca
gcaacaaaaaccaaatttacagtggatttggattcagatgatgatttctcagattttgat
gaaaaaactcaagatgaggattttgtcccatcagatgttagcccagttaagaccaaaact
tccccaccagtacctactaacaaagaactgaagccacagaagagtgccacatcagtaatg
gaccttgatgctggtggtgccaaggacagtgtaccaccttctctagattctccggccgct
gatttctcagctgaaactgaaatcataaaccctgtttctaaaaagaaggtagcggtgaag
aagacagcagcaaaaagtcagtcttccacctccactacaggtgccaaaaaaagggctgca
ccaaaaggaaccaaaaaggagccaggcttgaattctgatgtctctcaaaagcctgatcct
cccaaaaccaaaaatcgccgcaaaaggaagccatccacttctgatgattctgactctaat
tttgagaaaatgatttctaagacagtcacaagcaagaaatccaagggggagagtgaggat
ttccatctggacttagactcagctgtggctcctcgggccaaatctggacgggcaaagaaa
cctataaagtacctcgaagaatcagatgaagatgatctgttctaa

DBGET integrated database retrieval system