Panthera tigris altaica (Amur tiger): 102960964 Help Entry 102960964         CDS       T02988                                  Gene name MAPK3 Definition (RefSeq) mitogen-activated protein kinase 3   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01521   EGFR tyrosine kinase inhibitor resistance ptg01522   Endocrine resistance ptg01524   Platinum drug resistance ptg04010   MAPK signaling pathway ptg04012   ErbB signaling pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04022   cGMP-PKG signaling pathway ptg04024   cAMP signaling pathway ptg04062   Chemokine signaling pathway ptg04066   HIF-1 signaling pathway ptg04068   FoxO signaling pathway ptg04071   Sphingolipid signaling pathway ptg04072   Phospholipase D signaling pathway ptg04114   Oocyte meiosis ptg04140   Autophagy - animal ptg04150   mTOR signaling pathway ptg04151   PI3K-Akt signaling pathway ptg04210   Apoptosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04270   Vascular smooth muscle contraction ptg04350   TGF-beta signaling pathway ptg04360   Axon guidance ptg04370   VEGF signaling pathway ptg04371   Apelin signaling pathway ptg04380   Osteoclast differentiation ptg04510   Focal adhesion ptg04520   Adherens junction ptg04540   Gap junction ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04611   Platelet activation ptg04613   Neutrophil extracellular trap formation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04650   Natural killer cell mediated cytotoxicity ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04662   B cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04666   Fc gamma R-mediated phagocytosis ptg04668   TNF signaling pathway ptg04713   Circadian entrainment ptg04720   Long-term potentiation ptg04722   Neurotrophin signaling pathway ptg04723   Retrograde endocannabinoid signaling ptg04724   Glutamatergic synapse ptg04725   Cholinergic synapse ptg04726   Serotonergic synapse ptg04730   Long-term depression ptg04810   Regulation of actin cytoskeleton ptg04910   Insulin signaling pathway ptg04912   GnRH signaling pathway ptg04914   Progesterone-mediated oocyte maturation ptg04915   Estrogen signaling pathway ptg04916   Melanogenesis ptg04917   Prolactin signaling pathway ptg04919   Thyroid hormone signaling pathway ptg04921   Oxytocin signaling pathway ptg04926   Relaxin signaling pathway ptg04928   Parathyroid hormone synthesis, secretion and action ptg04929   GnRH secretion ptg04930   Type II diabetes mellitus ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04934   Cushing syndrome ptg04935   Growth hormone synthesis, secretion and action ptg04960   Aldosterone-regulated sodium reabsorption ptg05010   Alzheimer disease ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05034   Alcoholism ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05160   Hepatitis C ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05165   Human papillomavirus infection ptg05166   Human T-cell leukemia virus 1 infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05200   Pathways in cancer ptg05203   Viral carcinogenesis ptg05205   Proteoglycans in cancer ptg05206   MicroRNAs in cancer ptg05210   Colorectal cancer ptg05211   Renal cell carcinoma ptg05212   Pancreatic cancer ptg05213   Endometrial cancer ptg05214   Glioma ptg05215   Prostate cancer ptg05216   Thyroid cancer ptg05218   Melanoma ptg05219   Bladder cancer ptg05220   Chronic myeloid leukemia ptg05221   Acute myeloid leukemia ptg05223   Non-small cell lung cancer ptg05224   Breast cancer ptg05225   Hepatocellular carcinoma ptg05226   Gastric cancer ptg05230   Central carbon metabolism in cancer ptg05231   Choline metabolism in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102960964 (MAPK3)    04012 ErbB signaling pathway     102960964 (MAPK3)    04014 Ras signaling pathway     102960964 (MAPK3)    04015 Rap1 signaling pathway     102960964 (MAPK3)    04350 TGF-beta signaling pathway     102960964 (MAPK3)    04370 VEGF signaling pathway     102960964 (MAPK3)    04371 Apelin signaling pathway     102960964 (MAPK3)    04668 TNF signaling pathway     102960964 (MAPK3)    04066 HIF-1 signaling pathway     102960964 (MAPK3)    04068 FoxO signaling pathway     102960964 (MAPK3)    04072 Phospholipase D signaling pathway     102960964 (MAPK3)    04071 Sphingolipid signaling pathway     102960964 (MAPK3)    04024 cAMP signaling pathway     102960964 (MAPK3)    04022 cGMP-PKG signaling pathway     102960964 (MAPK3)    04151 PI3K-Akt signaling pathway     102960964 (MAPK3)    04150 mTOR signaling pathway     102960964 (MAPK3)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102960964 (MAPK3)   09143 Cell growth and death    04114 Oocyte meiosis     102960964 (MAPK3)    04210 Apoptosis     102960964 (MAPK3)    04218 Cellular senescence     102960964 (MAPK3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102960964 (MAPK3)    04520 Adherens junction     102960964 (MAPK3)    04540 Gap junction     102960964 (MAPK3)    04550 Signaling pathways regulating pluripotency of stem cells     102960964 (MAPK3)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102960964 (MAPK3)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102960964 (MAPK3)    04613 Neutrophil extracellular trap formation     102960964 (MAPK3)    04620 Toll-like receptor signaling pathway     102960964 (MAPK3)    04621 NOD-like receptor signaling pathway     102960964 (MAPK3)    04625 C-type lectin receptor signaling pathway     102960964 (MAPK3)    04650 Natural killer cell mediated cytotoxicity     102960964 (MAPK3)    04660 T cell receptor signaling pathway     102960964 (MAPK3)    04658 Th1 and Th2 cell differentiation     102960964 (MAPK3)    04659 Th17 cell differentiation     102960964 (MAPK3)    04657 IL-17 signaling pathway     102960964 (MAPK3)    04662 B cell receptor signaling pathway     102960964 (MAPK3)    04664 Fc epsilon RI signaling pathway     102960964 (MAPK3)    04666 Fc gamma R-mediated phagocytosis     102960964 (MAPK3)    04062 Chemokine signaling pathway     102960964 (MAPK3)   09152 Endocrine system    04910 Insulin signaling pathway     102960964 (MAPK3)    04929 GnRH secretion     102960964 (MAPK3)    04912 GnRH signaling pathway     102960964 (MAPK3)    04915 Estrogen signaling pathway     102960964 (MAPK3)    04914 Progesterone-mediated oocyte maturation     102960964 (MAPK3)    04917 Prolactin signaling pathway     102960964 (MAPK3)    04921 Oxytocin signaling pathway     102960964 (MAPK3)    04926 Relaxin signaling pathway     102960964 (MAPK3)    04935 Growth hormone synthesis, secretion and action     102960964 (MAPK3)    04919 Thyroid hormone signaling pathway     102960964 (MAPK3)    04928 Parathyroid hormone synthesis, secretion and action     102960964 (MAPK3)    04916 Melanogenesis     102960964 (MAPK3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102960964 (MAPK3)    04270 Vascular smooth muscle contraction     102960964 (MAPK3)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102960964 (MAPK3)   09156 Nervous system    04724 Glutamatergic synapse     102960964 (MAPK3)    04725 Cholinergic synapse     102960964 (MAPK3)    04726 Serotonergic synapse     102960964 (MAPK3)    04720 Long-term potentiation     102960964 (MAPK3)    04730 Long-term depression     102960964 (MAPK3)    04723 Retrograde endocannabinoid signaling     102960964 (MAPK3)    04722 Neurotrophin signaling pathway     102960964 (MAPK3)   09158 Development and regeneration    04360 Axon guidance     102960964 (MAPK3)    04380 Osteoclast differentiation     102960964 (MAPK3)   09159 Environmental adaptation    04713 Circadian entrainment     102960964 (MAPK3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102960964 (MAPK3)    05206 MicroRNAs in cancer     102960964 (MAPK3)    05205 Proteoglycans in cancer     102960964 (MAPK3)    05203 Viral carcinogenesis     102960964 (MAPK3)    05230 Central carbon metabolism in cancer     102960964 (MAPK3)    05231 Choline metabolism in cancer     102960964 (MAPK3)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102960964 (MAPK3)   09162 Cancer: specific types    05210 Colorectal cancer     102960964 (MAPK3)    05212 Pancreatic cancer     102960964 (MAPK3)    05225 Hepatocellular carcinoma     102960964 (MAPK3)    05226 Gastric cancer     102960964 (MAPK3)    05214 Glioma     102960964 (MAPK3)    05216 Thyroid cancer     102960964 (MAPK3)    05221 Acute myeloid leukemia     102960964 (MAPK3)    05220 Chronic myeloid leukemia     102960964 (MAPK3)    05218 Melanoma     102960964 (MAPK3)    05211 Renal cell carcinoma     102960964 (MAPK3)    05219 Bladder cancer     102960964 (MAPK3)    05215 Prostate cancer     102960964 (MAPK3)    05213 Endometrial cancer     102960964 (MAPK3)    05224 Breast cancer     102960964 (MAPK3)    05223 Non-small cell lung cancer     102960964 (MAPK3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102960964 (MAPK3)    05020 Prion disease     102960964 (MAPK3)    05022 Pathways of neurodegeneration - multiple diseases     102960964 (MAPK3)   09165 Substance dependence    05034 Alcoholism     102960964 (MAPK3)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102960964 (MAPK3)    04933 AGE-RAGE signaling pathway in diabetic complications     102960964 (MAPK3)    04934 Cushing syndrome     102960964 (MAPK3)   09171 Infectious disease: bacterial    05132 Salmonella infection     102960964 (MAPK3)    05135 Yersinia infection     102960964 (MAPK3)    05133 Pertussis     102960964 (MAPK3)    05152 Tuberculosis     102960964 (MAPK3)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102960964 (MAPK3)    05170 Human immunodeficiency virus 1 infection     102960964 (MAPK3)    05161 Hepatitis B     102960964 (MAPK3)    05160 Hepatitis C     102960964 (MAPK3)    05171 Coronavirus disease - COVID-19     102960964 (MAPK3)    05164 Influenza A     102960964 (MAPK3)    05163 Human cytomegalovirus infection     102960964 (MAPK3)    05167 Kaposi sarcoma-associated herpesvirus infection     102960964 (MAPK3)    05165 Human papillomavirus infection     102960964 (MAPK3)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102960964 (MAPK3)    05140 Leishmaniasis     102960964 (MAPK3)    05142 Chagas disease     102960964 (MAPK3)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102960964 (MAPK3)    01524 Platinum drug resistance     102960964 (MAPK3)    01522 Endocrine resistance     102960964 (MAPK3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptg01001]     102960964 (MAPK3)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102960964 (MAPK3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102960964 (MAPK3) Enzymes [BR:ptg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102960964 (MAPK3) Protein kinases [BR:ptg01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102960964 (MAPK3) Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      102960964 (MAPK3) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102960964 (MAPK3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kdo Motif Other DBs NCBI-GeneID:  102960964 NCBI-ProteinID:  XP_015398074 LinkDB All DBs Position Un AA seq 361 aa AA seqDB search LGQNPLLLPPLPAQAWVGPPGLDSPDVRPHRPHLSGPLSSAYDHVRKTRVAIKKISPFEH QTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQL SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHT GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL GILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDAKALDLLDRMLTFNPNKR ITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGALEA P NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt cttggccagaatcctctcttgctccctcccctccctgctcaggcctgggtggggccccca ggcctggactcccccgatgtaaggccacaccgaccacatctctctggccccctcagctca gcttatgaccacgtgcgcaagactcgcgtggccatcaagaaaatcagccccttcgagcat cagacctactgccagcgcacgctgcgggagatccagatcctgctgcgcttccgccatgag aacgtcattggcatccgggacattctgcgggcgcccaccctggaagccatgagggatgtc tacattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctg agcaacgaccacatttgctacttcctctaccagatcctgcggggcctcaagtatatccac tcagccaacgtgctccaccgggatttaaagccctctaacctgctcatcaacaccacctgc gaccttaagatctgtgattttggcctggcccggattgccgatcctgagcatgaccacact ggcttcctgacagaatatgtggccacacgctggtaccgggctccagaaatcatgcttaac tccaagggctacaccaagtccatcgacatctggtctgtgggctgcattctggctgagatg ctctccaacaggcccatcttccctggcaagcactacctggaccagctcaaccacattctg gggatcctgggctccccatcccaggaggacttgaattgtatcatcaacatgaaggcccga aactacctacagtctctgccctccaagaccaaggtggcctgggccaagctttttcccaag tcagatgccaaagccctggatctgctagaccggatgttgacctttaaccccaacaaacgg atcacagtggaggaagcactggctcacccctacctggagcagtactacgacccaacggat gagccagtggccgaggagcctttcaccttcgacatggagctggatgatctacccaaggag cggctgaaggagctcatcttccaggagacagcccgcttccagcctggggcactggaggcc ccctaa

Panthera tigris altaica (Amur tiger): 102964841 Help Entry 102964841         CDS       T02988                                  Gene name MAPK1 Definition (RefSeq) mitogen-activated protein kinase 1   KO K04371   mitogen-activated protein kinase 1/3 [EC:2.7.11.24] Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01521   EGFR tyrosine kinase inhibitor resistance ptg01522   Endocrine resistance ptg01524   Platinum drug resistance ptg04010   MAPK signaling pathway ptg04012   ErbB signaling pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04022   cGMP-PKG signaling pathway ptg04024   cAMP signaling pathway ptg04062   Chemokine signaling pathway ptg04066   HIF-1 signaling pathway ptg04068   FoxO signaling pathway ptg04071   Sphingolipid signaling pathway ptg04072   Phospholipase D signaling pathway ptg04114   Oocyte meiosis ptg04140   Autophagy - animal ptg04150   mTOR signaling pathway ptg04151   PI3K-Akt signaling pathway ptg04210   Apoptosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04270   Vascular smooth muscle contraction ptg04350   TGF-beta signaling pathway ptg04360   Axon guidance ptg04370   VEGF signaling pathway ptg04371   Apelin signaling pathway ptg04380   Osteoclast differentiation ptg04510   Focal adhesion ptg04520   Adherens junction ptg04540   Gap junction ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04611   Platelet activation ptg04613   Neutrophil extracellular trap formation ptg04620   Toll-like receptor signaling pathway ptg04621   NOD-like receptor signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04650   Natural killer cell mediated cytotoxicity ptg04657   IL-17 signaling pathway ptg04658   Th1 and Th2 cell differentiation ptg04659   Th17 cell differentiation ptg04660   T cell receptor signaling pathway ptg04662   B cell receptor signaling pathway ptg04664   Fc epsilon RI signaling pathway ptg04666   Fc gamma R-mediated phagocytosis ptg04668   TNF signaling pathway ptg04713   Circadian entrainment ptg04720   Long-term potentiation ptg04722   Neurotrophin signaling pathway ptg04723   Retrograde endocannabinoid signaling ptg04724   Glutamatergic synapse ptg04725   Cholinergic synapse ptg04726   Serotonergic synapse ptg04730   Long-term depression ptg04810   Regulation of actin cytoskeleton ptg04910   Insulin signaling pathway ptg04912   GnRH signaling pathway ptg04914   Progesterone-mediated oocyte maturation ptg04915   Estrogen signaling pathway ptg04916   Melanogenesis ptg04917   Prolactin signaling pathway ptg04919   Thyroid hormone signaling pathway ptg04921   Oxytocin signaling pathway ptg04926   Relaxin signaling pathway ptg04928   Parathyroid hormone synthesis, secretion and action ptg04929   GnRH secretion ptg04930   Type II diabetes mellitus ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg04934   Cushing syndrome ptg04935   Growth hormone synthesis, secretion and action ptg04960   Aldosterone-regulated sodium reabsorption ptg05010   Alzheimer disease ptg05020   Prion disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05034   Alcoholism ptg05132   Salmonella infection ptg05133   Pertussis ptg05135   Yersinia infection ptg05140   Leishmaniasis ptg05142   Chagas disease ptg05145   Toxoplasmosis ptg05152   Tuberculosis ptg05160   Hepatitis C ptg05161   Hepatitis B ptg05163   Human cytomegalovirus infection ptg05164   Influenza A ptg05165   Human papillomavirus infection ptg05166   Human T-cell leukemia virus 1 infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05170   Human immunodeficiency virus 1 infection ptg05171   Coronavirus disease - COVID-19 ptg05200   Pathways in cancer ptg05203   Viral carcinogenesis ptg05205   Proteoglycans in cancer ptg05206   MicroRNAs in cancer ptg05210   Colorectal cancer ptg05211   Renal cell carcinoma ptg05212   Pancreatic cancer ptg05213   Endometrial cancer ptg05214   Glioma ptg05215   Prostate cancer ptg05216   Thyroid cancer ptg05218   Melanoma ptg05219   Bladder cancer ptg05220   Chronic myeloid leukemia ptg05221   Acute myeloid leukemia ptg05223   Non-small cell lung cancer ptg05224   Breast cancer ptg05225   Hepatocellular carcinoma ptg05226   Gastric cancer ptg05230   Central carbon metabolism in cancer ptg05231   Choline metabolism in cancer ptg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102964841 (MAPK1)    04012 ErbB signaling pathway     102964841 (MAPK1)    04014 Ras signaling pathway     102964841 (MAPK1)    04015 Rap1 signaling pathway     102964841 (MAPK1)    04350 TGF-beta signaling pathway     102964841 (MAPK1)    04370 VEGF signaling pathway     102964841 (MAPK1)    04371 Apelin signaling pathway     102964841 (MAPK1)    04668 TNF signaling pathway     102964841 (MAPK1)    04066 HIF-1 signaling pathway     102964841 (MAPK1)    04068 FoxO signaling pathway     102964841 (MAPK1)    04072 Phospholipase D signaling pathway     102964841 (MAPK1)    04071 Sphingolipid signaling pathway     102964841 (MAPK1)    04024 cAMP signaling pathway     102964841 (MAPK1)    04022 cGMP-PKG signaling pathway     102964841 (MAPK1)    04151 PI3K-Akt signaling pathway     102964841 (MAPK1)    04150 mTOR signaling pathway     102964841 (MAPK1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102964841 (MAPK1)   09143 Cell growth and death    04114 Oocyte meiosis     102964841 (MAPK1)    04210 Apoptosis     102964841 (MAPK1)    04218 Cellular senescence     102964841 (MAPK1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102964841 (MAPK1)    04520 Adherens junction     102964841 (MAPK1)    04540 Gap junction     102964841 (MAPK1)    04550 Signaling pathways regulating pluripotency of stem cells     102964841 (MAPK1)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102964841 (MAPK1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102964841 (MAPK1)    04613 Neutrophil extracellular trap formation     102964841 (MAPK1)    04620 Toll-like receptor signaling pathway     102964841 (MAPK1)    04621 NOD-like receptor signaling pathway     102964841 (MAPK1)    04625 C-type lectin receptor signaling pathway     102964841 (MAPK1)    04650 Natural killer cell mediated cytotoxicity     102964841 (MAPK1)    04660 T cell receptor signaling pathway     102964841 (MAPK1)    04658 Th1 and Th2 cell differentiation     102964841 (MAPK1)    04659 Th17 cell differentiation     102964841 (MAPK1)    04657 IL-17 signaling pathway     102964841 (MAPK1)    04662 B cell receptor signaling pathway     102964841 (MAPK1)    04664 Fc epsilon RI signaling pathway     102964841 (MAPK1)    04666 Fc gamma R-mediated phagocytosis     102964841 (MAPK1)    04062 Chemokine signaling pathway     102964841 (MAPK1)   09152 Endocrine system    04910 Insulin signaling pathway     102964841 (MAPK1)    04929 GnRH secretion     102964841 (MAPK1)    04912 GnRH signaling pathway     102964841 (MAPK1)    04915 Estrogen signaling pathway     102964841 (MAPK1)    04914 Progesterone-mediated oocyte maturation     102964841 (MAPK1)    04917 Prolactin signaling pathway     102964841 (MAPK1)    04921 Oxytocin signaling pathway     102964841 (MAPK1)    04926 Relaxin signaling pathway     102964841 (MAPK1)    04935 Growth hormone synthesis, secretion and action     102964841 (MAPK1)    04919 Thyroid hormone signaling pathway     102964841 (MAPK1)    04928 Parathyroid hormone synthesis, secretion and action     102964841 (MAPK1)    04916 Melanogenesis     102964841 (MAPK1)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102964841 (MAPK1)    04270 Vascular smooth muscle contraction     102964841 (MAPK1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102964841 (MAPK1)   09156 Nervous system    04724 Glutamatergic synapse     102964841 (MAPK1)    04725 Cholinergic synapse     102964841 (MAPK1)    04726 Serotonergic synapse     102964841 (MAPK1)    04720 Long-term potentiation     102964841 (MAPK1)    04730 Long-term depression     102964841 (MAPK1)    04723 Retrograde endocannabinoid signaling     102964841 (MAPK1)    04722 Neurotrophin signaling pathway     102964841 (MAPK1)   09158 Development and regeneration    04360 Axon guidance     102964841 (MAPK1)    04380 Osteoclast differentiation     102964841 (MAPK1)   09159 Environmental adaptation    04713 Circadian entrainment     102964841 (MAPK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102964841 (MAPK1)    05206 MicroRNAs in cancer     102964841 (MAPK1)    05205 Proteoglycans in cancer     102964841 (MAPK1)    05203 Viral carcinogenesis     102964841 (MAPK1)    05230 Central carbon metabolism in cancer     102964841 (MAPK1)    05231 Choline metabolism in cancer     102964841 (MAPK1)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102964841 (MAPK1)   09162 Cancer: specific types    05210 Colorectal cancer     102964841 (MAPK1)    05212 Pancreatic cancer     102964841 (MAPK1)    05225 Hepatocellular carcinoma     102964841 (MAPK1)    05226 Gastric cancer     102964841 (MAPK1)    05214 Glioma     102964841 (MAPK1)    05216 Thyroid cancer     102964841 (MAPK1)    05221 Acute myeloid leukemia     102964841 (MAPK1)    05220 Chronic myeloid leukemia     102964841 (MAPK1)    05218 Melanoma     102964841 (MAPK1)    05211 Renal cell carcinoma     102964841 (MAPK1)    05219 Bladder cancer     102964841 (MAPK1)    05215 Prostate cancer     102964841 (MAPK1)    05213 Endometrial cancer     102964841 (MAPK1)    05224 Breast cancer     102964841 (MAPK1)    05223 Non-small cell lung cancer     102964841 (MAPK1)   09164 Neurodegenerative disease    05010 Alzheimer disease     102964841 (MAPK1)    05020 Prion disease     102964841 (MAPK1)    05022 Pathways of neurodegeneration - multiple diseases     102964841 (MAPK1)   09165 Substance dependence    05034 Alcoholism     102964841 (MAPK1)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102964841 (MAPK1)    04933 AGE-RAGE signaling pathway in diabetic complications     102964841 (MAPK1)    04934 Cushing syndrome     102964841 (MAPK1)   09171 Infectious disease: bacterial    05132 Salmonella infection     102964841 (MAPK1)    05135 Yersinia infection     102964841 (MAPK1)    05133 Pertussis     102964841 (MAPK1)    05152 Tuberculosis     102964841 (MAPK1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102964841 (MAPK1)    05170 Human immunodeficiency virus 1 infection     102964841 (MAPK1)    05161 Hepatitis B     102964841 (MAPK1)    05160 Hepatitis C     102964841 (MAPK1)    05171 Coronavirus disease - COVID-19     102964841 (MAPK1)    05164 Influenza A     102964841 (MAPK1)    05163 Human cytomegalovirus infection     102964841 (MAPK1)    05167 Kaposi sarcoma-associated herpesvirus infection     102964841 (MAPK1)    05165 Human papillomavirus infection     102964841 (MAPK1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102964841 (MAPK1)    05140 Leishmaniasis     102964841 (MAPK1)    05142 Chagas disease     102964841 (MAPK1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102964841 (MAPK1)    01524 Platinum drug resistance     102964841 (MAPK1)    01522 Endocrine resistance     102964841 (MAPK1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ptg01001]     102964841 (MAPK1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102964841 (MAPK1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102964841 (MAPK1) Enzymes [BR:ptg01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      102964841 (MAPK1) Protein kinases [BR:ptg01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    102964841 (MAPK1) Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Centromeric chromatin formation proteins    SAC (spindle assembly checkpoint) factors     Protein kinases      102964841 (MAPK1) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102964841 (MAPK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo Kinase-like Motif Other DBs NCBI-GeneID:  102964841 NCBI-ProteinID:  XP_007091155 LinkDB All DBs Position Un AA seq 329 aa AA seqDB search MDRSYLIFNSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIR APTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLK PSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDI WSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKN KVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPVAEAPFKF DMELDDLPKEKLKELIFEETARFQPGYRS NT seq 990 nt NT seq  +upstreamnt  +downstreamnt atggacaggtcataccttattttcaactctgcttatgataatgtcaacaaagttcgagta gctatcaagaaaatcagtccttttgagcaccagacctactgccagagaaccctgagggag ataaaaatcttactgcgcttcagacatgagaacatcattggaatcaatgatattattaga gcgccaaccatcgagcaaatgaaagatgtatatatcgtacaggacctcatggaaacagat ctctacaagctcttgaagacacaacacctcagcaacgaccatatctgctattttctttac cagatcctcagagggttaaaatatatccattcagctaatgtactgcaccgtgacctcaaa ccttccaacctgctgctcaacaccacctgtgatctcaagatctgtgactttggtttggcc cgcgttgcagatccagaccatgatcacacagggttcctgacggagtacgtagccacacgt tggtaccgggctccagaaattatgttgaattccaagggctataccaagtccattgatatt tggtctgtaggctgcattctggcagagatgctgtccaacaggcccatcttcccggggaag cattatctcgaccagctgaaccacattctgggtattcttggatccccatcacaggaagac ctgaattgtataataaatttaaaagctagaaactacttgctttctcttccacacaaaaat aaggtgccatggaacaggctgttcccaaatgctgattccaaagctctggatttactggac aaaatgttgacgttcaaccctcacaagaggattgaagtagaacaggctctggcccatcca tatctggagcagtattacgacccaagtgatgagcccgtcgctgaggcaccgttcaagttt gacatggagctagacgacctgcccaaggaaaagctcaaagagctcatcttcgaagagacg gccaggttccagccgggatacaggtcttaa

DBGET integrated database retrieval system