KEGG   Panthera tigris altaica (Amur tiger): 102961107Help
Entry
102961107         CDS       T02988                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00020  Citrate cycle (TCA cycle)
ptg00190  Oxidative phosphorylation
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg04714  Thermogenesis
ptg04932  Non-alcoholic fatty liver disease (NAFLD)
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05016  Huntington disease
Module
ptg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ptg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102961107 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102961107 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102961107 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    102961107 (SDHB)
   05012 Parkinson disease
    102961107 (SDHB)
   05016 Huntington disease
    102961107 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102961107 (SDHB)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102961107 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102961107
NCBI-ProteinID: NP_001277542
UniProt: W6FSU0
LinkDB All DBs
Position
Un
AA seq 281 aa AA seqDB search
MAAAAVGVSLRRRFPATALGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPRMQ
TYEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDT
NLSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREK
LDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFS
LYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggtcggagtctccttgaggcgccggttcccggccacggcccttggc
ggagcctgcctgcaggcctgccggggggcacagacagcggcagccacagctccccgaatc
aagaagtttgccatctaccgatgggacccagacaagacgggagataagcctcgtatgcaa
acttatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagatt
aagaatgaaatcgattcgactttgactttccgacgatcatgcagagaaggcatctgtggc
tcttgcgcgatgaacatcaacggaggcaacactctggcttgcacccgcaggattgacacc
aacctcagcaaagtctccaaaatctaccctcttccacatatgtatgtgataaaggatctt
gttcccgacttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaag
aaggatgaatcccaggaaggcaagcagcagtacctgcagtccatagaagatcgtgagaaa
ctggacgggctgtatgagtgtattctctgtgcctgctgcagcaccagctgccccagctac
tggtggaacggagacaaatacctgggacctgcagtccttatgcaggcctatcgctggatg
atcgactccagagacgacttcacggaggagcgcctggccaagctgcaggacccgttctcc
ctgtatcgctgccacaccatcatgaactgcacgaggacctgccccaaggggctgaatcca
ggcaaagctattgctgaaatcaagaaaatgatggccacctataaggggaagaaagcgtca
gtgtaa

DBGET integrated database retrieval system