KEGG   Panthera tigris altaica (Amur tiger): 102961472
Entry
102961472         CDS       T02988                                 

Gene name
CACNA1E
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04020  Calcium signaling pathway
ptg04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102961472 (CACNA1E)
   04020 Calcium signaling pathway
    102961472 (CACNA1E)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102961472 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ptg04040]
    102961472 (CACNA1E)
Ion channels [BR:ptg04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102961472 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102961472
NCBI-ProteinID: XP_015399262
LinkDB
Position
Un
AA seq 1990 aa
MTGMKLIWESFLSEAEQITALPSSLLMNLILLIHREFAKERERVENRRAFMKLRRQQQIE
RELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRTEAMTRDSSDEHCVDISS
VGTPLARASIKSAKVDGASYFRHKERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVH
HNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDFGVTVGSIFEVVW
AIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVF
ALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGM
WSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSP
MSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRRHMQMSSQEAL
NKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLGLGLEKCEEERISRGGSLKGD
GGDLPSALDNQRSPLSLGKREPPWLGRPCHGNCDSTQQEAGGGETVVTFEDRARHRQSQR
RSRHRRVRTEGKEPSSTSRSRSASQERSLDEGGPTEGEKDREPRASHGGKEPTIQEEERG
QDLRRTNSLMVPRGSGLAGALDEASTPLVQPQPELEMGKDTALTEQEPEGSSEQALLGDV
QLDMGRAISQSEPDLSCVTANTDKATTESTSVTVAIPDVGPLVDSTVVHISNKTDGEASP
LKEAEIKEEEEEVEKKQQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMC
ILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYF
RDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAV
FDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEK
NKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRME
MSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTR
YMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFT
MVFSLECVLKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLF
RAALRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRH
NNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYF
VSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIPYKD
MYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAK
GGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKV
KKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPYLQQDPVSGLSGRSGYPSMSPLSP
QEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSSNHGIYLPSDTQEHTGSGRASSMPR
LTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAH
RLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERHESRSPS
EGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHTGSMS
PPADGSEGGSPLASQALESPEAGLAESSSSRHVQQGQHASPQRYISEPYLALHEDSHASD
CGEEETLTFEAAVATSLGPSNTIGSPPPLRHSWQMPNGHYRRRRRGGPGPGVMCGAVSDL
LSDTEEDDKC
NT seq 5973 nt   +upstreamnt  +downstreamnt
atgactgggatgaaactgatctgggaaagcttcttgagtgaggccgaacaaatcacggca
ttacccagttccctgcttatgaatctcatccttctcatccacagggaatttgccaaagag
agagagagagtggagaaccggagagctttcatgaaattgcggcggcagcagcagattgag
cgtgagctgaacgggtaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaa
gaaaataaaaacgctggaacatcagccttagaagtgcttcgaagggcaaccatcaaaagg
agccggacagaggccatgacgcgagactccagcgatgagcactgtgttgatatctcctct
gtgggcacacctcttgcccgagccagcatcaaaagtgcaaaggtggatggggcctcctat
ttccggcacaaagaaaggcttctgcgcatctctatccgccacatggtcaaatcccaggtg
ttttactggattgtgttgagccttgtggctctcaacactgcctgtgtggccatcgtccat
cacaaccagccccagtggctcacccatctcctctactatgcagaatttctgtttctggga
ctgttcctcttggagatgtccttaaagatgtatggcatggggcctcgactttactttcac
tcttcattcaactgttttgattttggggtcacagtgggcagtatctttgaagtggtctgg
gcaatcttcagacctggtacatcttttggaatcagtgtcttgcgagctctccggcttcta
agaatatttaaaataaccaagtattgggcatctctgcgaaatctggtggtctccttgatg
agttctatgaagtctatcatcagtttgctcttcctcctcttcctcttcatcgttgtcttt
gctctcctaggaatgcagctgtttggcggcaggtttaactttaatgatgggactccttca
gcaaactttgacacctttccggcagccatcatgactgtattccagatcctaacaggtgag
gactggaatgaggttatgtacaatgggatccgctcccagggtggagttagctcaggcatg
tggtcagctatctatttcattgtgctcaccttgtttggaaactacacactgctgaatgtg
ttcttggccattgctgtagacaatctggccaatgcccaagagctgaccaaggatgaacaa
gaagaagaggaggccttcaaccagaaacatgcattgcagaaggccaaggaggtcagcccg
atgtctgcacccaacatgccttctatcgaaagagacagaaggagaagacaccacatgtcg
atgtgggagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtcagtg
tgggagcagcgcaccagccagctgagaaggcacatgcagatgtctagccaggaggccctc
aacaaagaggaggccccaccaatgaaccccctcaaccccctcaacccgctgagccccctc
aacccactcaacgcccacccgagcctctaccggagacccagacccattgagggcctgggc
ctgggcctggagaaatgtgaggaggagcgcattagccgcggggggtccctcaagggggac
ggaggggacctgccgagtgccttggacaaccagaggagccccttgtccttgggcaaacgg
gagccaccatggctgggcaggccgtgtcatgggaactgtgattcgacccagcaggaggct
gggggaggggagactgtggtgaccttcgaggaccgggccaggcacaggcagagccagcgg
cgcagcaggcaccgtcgtgtcaggaccgaaggcaaggaaccctcctccacctcccggagc
aggtctgccagccaggagcggagtctggatgaaggggggcccaccgagggggagaaggac
cgcgagcccagggccagccacgggggcaaggaacccacaatccaggaagaggaaagaggc
caagacttaaggaggaccaacagtctgatggtgcccagaggctccgggctggcaggagcc
ctcgatgaggccagcacgcccttagtccagccgcagccagagttggaaatggggaaggac
acggctctgacagagcaggagccggagggcagcagtgagcaagctctgctgggggatgtg
cagttggacatgggccgggccatcagtcagagtgagcccgacctctcctgtgtcacggcc
aacacggacaaggccaccactgagagtaccagcgtcaccgtcgccatccccgacgtgggc
cccttggtggactcaactgtggttcacatcagcaacaagactgatggagaagccagtcct
ttgaaggaggcagagatcaaagaggaggaggaagaggtagagaagaagcagcaaaagaag
gagaagcgtgagacgggcaaagccatggttccccacagctctatgttcatcttcagcacc
accaacccgattcgcagggcctgccactacattgtgaacctgcgctactttgagatgtgc
attctcctggtgatcgcagccagcagcattgccctggcagccgaggaccctgtcctgacc
aactcggagcgcaacaaagtcctgaggtattttgactatgttttcactggcgtgttcacc
tttgagatggttataaagatgatagaccagggcttgatcctgcaggatgggtcctacttc
cgagacctatggaacatcctggactttgtggtggtggttggcgcattggtggcctttgct
ttggcgaatgccttgggaactaacaaggggcgggacatcaagaccatcaaatctctgagg
gtgctccgagttctgaggccgctgaagaccatcaagcgcttgcccaagctcaaggctgtc
tttgattgcgtggtgacttccttgaagaatgtcttcaacatactcattgtctacaagctc
ttcatgttcatcttcgctgtcatcgcagttcagctcttcaagggaaagttcttttattgc
acggacagttccaaggacacagagaaggagtgcataggcaactatgtagatcatgaaaaa
aacaagatggaggtgaaaggccgggaatggaagcgccatgaattccactacgacaacatt
atctgggccctgctgaccctcttcactgtctccacaggggaaggatggcctcaagtctta
cagcattctgttgatgtgacagaggaagaccgaggaccaagccgcagcaaccgcatggag
atgtccatcttttacgtggtctactttgtggtcttccctttcttctttgtcaatatcttt
gtggctctcatcatcatcaccttccaggagcaaggagacaagatgatggaggagtgcagc
ctggagaagaacgagagggcgtgcatcgactttgccatcagtgccaaacctctcacccgc
tacatgccgcagaacaggcataccttccagtaccgcgtctggcacttcgtggtgtcgccg
tcctttgagtacaccattatggccatgatcgccttgaacaccgtcgtgctgatgatgaag
tactactctgctccctgtacctatgaactggccctgaagtacctgaatattgccttcacc
atggtgttttctctggaatgtgtcctaaagatcatcgcgtttggcttcttgaactatttt
cgagatacctggaatatctttgactttatcaccgtgattggcagtatcacagaaatcatt
ctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttc
cgcgctgctctacgtcagggctacaccatccgtattttactttggacttttgtacagtcc
tttaaggccctcccctacgtctgccttttgattgccatgcttttcttcatctatgccatc
atcgggatgcaggtattcggaaacataaaattagatgaggagagtcacatcaaccgacac
aacaacttccggagtttcttcgggtccctcatgttactcttcaggagtgccacaggtgag
gcctggcaggagataatgctgtcgtgcctcggggagaaaggctgtgagcccgacaccact
gcgccatcagggcagaatgagaatgagcgctgtggcaccgatctggcctatgtttacttt
gtctccttcatcttcttctgctccttcttgatgctcaacctgtttgtggccgtcatcatg
gacaactttgagtacctgactcgggactcatccatcctagggcctcaccacttggacgag
tttgtccgcgtctgggcagaatatgacagagctgcatgcggcaggatcccgtataaggat
atgtacaaattagtgcgggtgatctcgccgcctctgggcctgggagagaactgcccctac
agggtggcttgcaagaggttggtcctgatgaatatgccagtagctgaggacatgacagtc
cacttcacctccacactcatggctctgatacggacagcactggacatcaaaatcgccaaa
ggtggtgcagacagacagcagctagactcagaactacaaaaggagaccctggccatctgg
cctcacctatcccagaagatgctagatctgctcgtgcccatgcccaaagcctctgacctg
actgtgggcaaaatctatgcagcaatgatgatcatggactactataaacagagtaaggtg
aagaagcagaggcagcagctggaggaacagaaaaacgcacccatgttccagcgcatggag
ccttcatctctgcctcaggagatcattgctaatgccaaagccctgccttatctccagcag
gaccctgtctcaggcttgagtggccgtagtggatacccttcgatgagtccgctctccccc
caggaaatattccagttggcttgtatggacccagccgatgatggacagtttcaggaacag
cagtctctggagccagaggttagtgaattaaaaagcgtgcagtcctctaaccatggcatc
taccttccttcggacacccaggagcatacgggatctgggagggcatcctctatgccacgc
ctgactgtggatccccaggtggtgacagaccctagctccatgagacgctcattttccacc
attcgggataagcgttcaaattcctcatggttggaggaattctctatggagagaagcagt
gaaaacacctacaagtcacgtcgccggagttaccactcctccctgagactgtcagctcat
cgcctgaattctgactcaggccacaagtctgacacccaccgctcagggggcagagagcgg
ggacggtcaaaagagcgaaagcatcttctctctcccgatgtctcccgctgcaactcagag
gagcgagggacccaggctgactgggagtcccccgagcgccatgagtccaggtctcccagc
gagggcaggtcacagacccccaacagacagggcacgggttccctgagtgagagctccatc
ccctccatctctgacaccagcactccaagacgaagtcgccggcagctcccgcccgtgcca
ccaaagcctcggcccctcctttcctacagctccctgattcgacacaccgggagcatgtct
ccaccggctgatggaagcgagggtggctctcctctggcctcccaagccctggagagccct
gaggccggcctggcagagtcttccagctcccggcacgtacagcagggtcagcacgcctcc
ccacagcgctacatctccgagccctacctggccctgcacgaagactcccacgcctcggac
tgtggcgaggaggagacgctcaccttcgaagcagctgtggccaccagcctgggcccctcc
aacaccatcggctcccccccaccgctgcggcacagctggcagatgcccaatgggcactat
cgacggcggaggcgcggggggcccgggccaggtgtgatgtgtggggctgtcagcgacctc
ctgagtgacacggaagaggacgacaagtgctag

DBGET integrated database retrieval system