KEGG   Panthera tigris altaica (Amur tiger): 102961536
Entry
102961536         CDS       T02988                                 

Gene name
IL17D
Definition
(RefSeq) interleukin 17D
  KO
K05492  interleukin 17D
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04625  C-type lectin receptor signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04657  IL-17 signaling pathway
ptg04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102961536 (IL17D)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102961536 (IL17D)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102961536 (IL17D)
   04659 Th17 cell differentiation
    102961536 (IL17D)
   04657 IL-17 signaling pathway
    102961536 (IL17D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102961536 (IL17D)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102961536 (IL17D)
SSDB
Motif
Pfam: IL17
Other DBs
NCBI-GeneID: 102961536
NCBI-ProteinID: XP_007074472
LinkDB
Position
Un
AA seq 282 aa
SSPLDIRRTHTVDLLDRGLAWTLTACQINCRPHLSSCPSNQWSPGLPVRGRNLLEAALSP
RVVCSVAPGHELSPRPLPCRISYDPARYPKYLPEAYCLCRGCLTGLFGEEDLRFRSAPVY
MPTVILRRTSACAGGRWVYTEEYVTVPVDGAVAVPGFGQAPVADHNGTDGAKCDPFPLKV
PAGCRAEDREAPGLRSPPPGQGFQGSQTWFRSRFIQLNICFRFESKWGQVRGGGRMWCLC
HVSRIQVSVSGPQELAEWEKRANLRFPEVRIGGLFFPPCDVS
NT seq 849 nt   +upstreamnt  +downstreamnt
tcttcaccgcttgacatccggcggactcacacggttgacctgttagatcggggtctcgcg
tggacgctaaccgcctgccaaattaactgccggccccacctttcttcctgccccagtaac
cagtggtccccgggcttaccggtccgaggccgaaatcttttggaggctgccctctctccg
cgcgtcgtgtgttccgttgccccagggcacgaactgagcccgcgccctcttccctgcaga
atttcctacgaccctgccaggtaccccaagtacctgcccgaggcctactgcctgtgcagg
ggctgcctgaccgggctcttcggggaggaggacctacgtttccggagcgcgccggtgtac
atgcccaccgtcatcctgcggcggacctcggcctgcgcgggcggccgctgggtgtacacc
gaggagtacgtcaccgtgcccgtggatggcgcggtggccgtccccggattcggccaggcc
ccagtcgctgaccacaacggaacggacggggctaaatgtgacccgtttccgctgaaggtc
cccgcaggctgccgcgcggaggacagggaagccccggggctccgctcgccgcccccaggc
caggggttccagggatctcagacttggttcaggagcagattcatacagctgaacatttgt
tttcgctttgaaagtaagtggggccaagtaagaggtggaggtagaatgtggtgtctctgc
cacgtgtcaagaatccaagtctcagtttcagggcctcaggaactagccgaatgggagaag
cgggccaacttacgattcccggaagtccgtattgggggcctctttttcccaccctgcgat
gtgagctaa

DBGET integrated database retrieval system