KEGG   Panthera tigris altaica (Amur tiger): 102961564Help
Entry
102961564         CDS       T02988                                 

Gene name
ADA
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg01100  Metabolic pathways
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102961564 (ADA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102961564 (ADA)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     102961564 (ADA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deaminase DUF3876
Motif
Other DBs
NCBI-GeneID: 102961564
NCBI-ProteinID: XP_015391029
LinkDB All DBs
Position
Un
AA seq 364 aa AA seqDB search
MTQTPAFDKPKVELHIHLDGAIKPETILYYGKKRGIALPADTAEELQDIISMDKPTSLPD
FLAKFDYYMPVIAGSREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWDQA
EGDLTPDEVVAVVNQGLQEGERDFGVKVRSILCCMRHQPSEYALSPVELCKKYQHQTVVA
IDLAGEETIQGSSLFPGHVKAYEEAVRSGIHRTVHAGEVGSSEVVRQAVDTLKTERVGHG
YHTLDDEALYTRLRRENLHFEVCPWSSYLTGAWKSDTEHPVVRLKRDQANYSLNTDDPLI
LKSTLETDYQMTKQNMGFTEEEFKRLNINAAKSSFLPEDEKRKLLDLLYKAYGMPSLAAA
GQRL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacccagacgcccgccttcgacaagcccaaagtggagctgcatatccacctggatggg
gccatcaagcctgaaaccatcttatactatggcaagaagagggggattgccctccccgct
gacaccgcagaggagctgcaggacatcatcagcatggacaagcccaccagcctcccagat
ttcctggccaagtttgactactacatgcctgtcatcgcgggctcccgggaggccatcaaa
aggatcgcctatgagtttgtcgagatgaaggccaaggagggcgtggtgtatgtggaggtg
cgttacagcccgcacctgctggccaactctaaagtggagccgatcccctgggaccaggca
gaaggggatctcacccccgacgaggtggtggctgtggtgaaccagggcctgcaggaggga
gagagagactttggggtgaaggtgcggtctatcctgtgctgcatgcgccaccagcccagt
gagtacgccctcagccctgtggagctgtgtaagaagtaccagcatcagactgtggtggcc
attgacctggctggagaggagaccatccaagggagcagcctcttcccgggacacgtgaag
gcctacgaggaggccgtgaggagcggcattcaccgcactgtccatgcaggggaggtgggc
tcctcggaggtggtgagacaggccgtggacacgctgaagacagagagggtgggacacggc
taccacacgctggatgacgaggccctttacacccggctgcgccgcgaaaacctgcatttc
gaggtctgcccctggtccagctacctcacaggtgcctggaagtcggacacggagcacccg
gtggttcggctcaaacgtgaccaggctaactactcactcaacacggatgaccctctcatc
ttgaagtccaccctggaaaccgattaccaaatgaccaaacagaacatgggctttactgaa
gaggagttcaagaggctgaacatcaatgcggcaaagtccagtttcctcccggaagatgag
aagaggaagcttcttgatctgctctataaagcctatgggatgccatctttggctgctgca
gggcagcgtctctga

DBGET integrated database retrieval system