KEGG   Panthera tigris altaica (Amur tiger): 102961625
Entry
102961625         CDS       T02988                                 

Gene name
LAP3
Definition
(RefSeq) leucine aminopeptidase 3
  KO
K11142  cytosol aminopeptidase [EC:3.4.11.1 3.4.11.5]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00330  Arginine and proline metabolism
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    102961625 (LAP3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102961625 (LAP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102961625 (LAP3)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     102961625 (LAP3)
    3.4.11.5  prolyl aminopeptidase
     102961625 (LAP3)
Peptidases and inhibitors [BR:ptg01002]
 Metallo peptidases
  Family M17: leucyl aminopeptidase family
   102961625 (LAP3)
SSDB
Motif
Pfam: Peptidase_M17 Peptidase_M17_N PAW
Other DBs
NCBI-GeneID: 102961625
NCBI-ProteinID: XP_015398201
LinkDB
Position
Un
AA seq 488 aa
MTKGLVLGIYNKEKEDDVPQFTSAGENFDKLVSGKLREVLNISGPPLKAGKTRTFYGLHE
DFPSVVVVGLGRKTAGIDDQENWHEGKENIRAAVAAGCRQIQDLEISSVEVDPCGDAQAA
AEGAVLGLYEYDDLKQKKKVVVSAKLHGSGDQEAWQKGVLFASGQNLARHLMETPANEMT
PTRFAEIIEKNLKSASSKTEVHVRPKSWIEEQEMGSFLSVAKGSDEPPVFLEIHYRGSPN
AGEAPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIVGL
APLCENMPSGKANKPGDVVKARNGKTIQIDNTDAEGRLILADALCYAHTFNPKVIINAAT
LTGAMDIALGSGATGVFTNSSWLWNRLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVN
NIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFL
LHFSQDSA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgacgaagggtcttgttttaggaatctataacaaagaaaaagaagacgatgtgccgcag
tttacaagtgcaggagagaatttcgataaattagtgtctggaaagttgagagaagttttg
aacatatctggacctcctctgaaggcaggcaaaacccgaaccttttatggtctgcatgag
gacttcccgagcgtggtggtggtcggcctcggcagaaagacagctggaattgatgaccag
gaaaactggcatgaaggcaaagaaaacatcagagctgctgtggcagcggggtgcaggcag
attcaggacctggagatctcttcggtggaggtggatccctgtggagatgcgcaggcggct
gcagaaggagcagtgctcggtctctatgagtatgatgacctgaagcagaagaagaaagta
gttgtatcggcaaagctccacggaagtggggaccaggaggcctggcagaagggagtcctc
tttgcttctggacagaacttggcacgccacctgatggagactccagccaatgagatgacg
ccaaccagatttgctgaaattattgagaagaatctcaagagtgctagtagtaagacagag
gttcatgtcagacccaaatcttggattgaggaacaggaaatgggatcgttcctaagtgtg
gccaaaggatccgatgagcctccagtcttcttggaaattcactacagaggcagccccaat
gcaggcgaagcacccctggtgtttgttgggaagggaattacctttgacagtggcggcatt
tccatcaaggcctctgcaaatatggacctcatgagggctgacatgggaggagctgccacc
atctgctcagccatcgtctctgctgccaagctgaacctacccattaacatcgtaggtttg
gcccctctctgtgaaaacatgcccagcggtaaggccaacaagcctggggatgtcgttaaa
gccaggaacgggaagaccatacagatcgataacacggatgcagaggggaggctcatactg
gctgatgcactttgttatgcgcacacctttaacccaaaggtcatcatcaatgctgccacc
ctaacaggtgccatggacatagctctggggtccggtgccactggggtctttaccaattcg
tcctggctgtggaacagactatttgaggccagcattgaaacaggggaccgtgtctggagg
atgcctctctttgagcattatacaagacaagttgtagactgccaacttgctgatgtcaat
aacattggaaaatacaggtctgcaggagcatgtacggctgcagcattcctgaaagaattt
gtgactcatcctaagtgggcacatttagatatagcaggtgtgatgaccaacaaagatgag
gttccgtatctgcggaagggcatgaccgggagacccacaaggaccctgatagagttcttg
cttcatttcagtcaagatagtgcttag

DBGET integrated database retrieval system