KEGG   Panthera tigris altaica (Amur tiger): 102961961
Entry
102961961         CDS       T02988                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04020  Calcium signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04510  Focal adhesion
ptg04520  Adherens junction
ptg04530  Tight junction
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05215  Prostate cancer
ptg05219  Bladder cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102961961 (ERBB2)
   04012 ErbB signaling pathway
    102961961 (ERBB2)
   04066 HIF-1 signaling pathway
    102961961 (ERBB2)
   04020 Calcium signaling pathway
    102961961 (ERBB2)
   04151 PI3K-Akt signaling pathway
    102961961 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102961961 (ERBB2)
   04520 Adherens junction
    102961961 (ERBB2)
   04530 Tight junction
    102961961 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102961961 (ERBB2)
   05206 MicroRNAs in cancer
    102961961 (ERBB2)
   05205 Proteoglycans in cancer
    102961961 (ERBB2)
   05230 Central carbon metabolism in cancer
    102961961 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102961961 (ERBB2)
   05226 Gastric cancer
    102961961 (ERBB2)
   05219 Bladder cancer
    102961961 (ERBB2)
   05215 Prostate cancer
    102961961 (ERBB2)
   05213 Endometrial cancer
    102961961 (ERBB2)
   05224 Breast cancer
    102961961 (ERBB2)
   05223 Non-small cell lung cancer
    102961961 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102961961 (ERBB2)
   01524 Platinum drug resistance
    102961961 (ERBB2)
   01522 Endocrine resistance
    102961961 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102961961 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102961961 (ERBB2)
   04090 CD molecules [BR:ptg04090]
    102961961 (ERBB2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102961961 (ERBB2)
Protein kinases [BR:ptg01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102961961 (ERBB2)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102961961 (ERBB2)
CD molecules [BR:ptg04090]
 Proteins
  102961961 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH CBP_BcsF
Other DBs
NCBI-GeneID: 102961961
NCBI-ProteinID: XP_015394617
LinkDB
Position
Un
AA seq 1240 aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLHANASLSFLQDIQEVQGYVLIAHNQ
VRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLDSGTPATGAALGGLRELQLRSLTEILK
GGVLIQRNPQLCHQDTILWKDIFHKNNQLALMLIDTNRSRACQPCSPACKDSHCWGASSG
DCQSLTRTVCAGGRRRPRLQACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGA
SCVTACPYNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREA
RAVTSANIQEFVGCKKIFGSLAFLPESFEGDPASNTAPLQPEQLRVFEALEEITGYLYIS
AWPDSLPNLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNSR
LCFVHTVPWDQLFRNPHQALLHSANRPEDECAGEGLACYPLCAHGHCWGGGPTQCVNCSQ
FLRGQECVXXXXRGTRGRAGGAAGVGHGGSFQTPSSAIPSVRLPREYVKDRFCLPCHPEC
QPQNGSVTCLGSEADQCVACAHYKDPPFCVARCPSGVKPDLSFMPIWKFADEEGTCQPCP
INCTHSCADLDEKGCPAEQRASPVTSIIAAVVGILLVVVVGLVLGILIKRRRQKIRKYTM
RRLLQETELVEPLTPSGAMPNQAQMRILKETELRKVKVLGSGAFGTVYKGIWIPDGENVK
IPVAIKVLRENTSPKANKEILDEAYVMAGVGSPYVSRLLGICLTSTVQLVTQLMPYGCLL
DHVREHRGRLGSQDLLKDCQGMHLGGLSSAGGMSYLEDVRLVHRDLAARNVLVKSPNHVK
ITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFTHQSDVWSYGVTVWELMTFGA
KPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKGWMIDSECRPRFRELVAEFSRMA
RDPQRFVVIQNEDLGPASPLDSTFYRSLLEDEDMGDLVDAEEYLVPQQGFFCPDPAPGAG
GTAHHRHRSSSTRSGGGELTLGLEPSEEEPPKSPLAPSEGAGSDVFDGDLGMGAAKGLQS
LSPQDPSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYVNQPEVWPKPPSPLEGPLPPS
RPAGATLERPKTLSPKALSPGKNGVVKDVFAFGGAVENPEYLAPRGRAAPQPHPPPAFSP
AFDNLYYWDQDTSERGSPPSTFEGTPTAENPEYLGLDETV
NT seq 3723 nt   +upstreamnt  +downstreamnt
atgaagctgcggctcccagccagtcccgagacccacctggacatgctccgccacctctac
cagggctgtcaagtggtacagggtaacctggagctcacctacctgcatgccaatgccagc
ctctccttcctgcaggatattcaggaggtgcaaggctatgtgctcattgcccacaaccaa
gtgagacaggtcccactgcagaggctacgaatcgtgcgaggcacccagctctttgaggac
aactacgccctggccgtgctggacaacggagacccactggacagtggcacccctgctaca
ggggctgccctaggagggctgcgggagctgcagctccgaagcctcacagagatcctgaag
ggaggggtcctcattcagcggaacccgcagctctgccaccaggacacgattctgtggaag
gacatcttccacaagaacaaccagctggccctcatgctgatagacaccaaccgctctcgg
gcctgccaaccctgttctccagcttgtaaagactcccactgctggggagcaagttccggg
gactgtcagagcttgactcgaactgtctgtgctggcggccggcgccgcccccgcctccag
gcctgcctccacttcaaccacagtggcatctgtgagctgcactgcccagccctggtcacc
tacaacacggacaccttcgaatccatgcccaaccctgagggccgttataccttcggtgcc
agctgtgtgactgcctgtccctacaactacctgtctacggacgtgggatcctgcaccctg
gtctgtcccctgaacaaccaagaggtgacagctgaggatggaacacagcggtgtgagaaa
tgcagcaagccctgtgcccgagtgtgctacggcctaggcatggagcacctgcgggaggcg
agggcagtcaccagtgccaacatccaagaatttgtcggctgcaagaagatctttgggagc
ctggcgtttctgccagagagctttgagggggacccagcctccaacactgcccccctgcag
cctgagcagctcagagtgtttgaggctctggaggagattacaggttacctgtacatctca
gcgtggccagacagcttgcctaacctcagtgtcttccagaacctcagagtgatccggggc
cgagttctgcatgacggtgcttactcgctgacccttcaagggctgggcatcagctggctg
gggctgcgttcgctgcgggagctgggcagtgggctggccctcatccaccgcaactctcgc
ctctgcttcgtacacacggtgccctgggaccagctcttccggaacccccaccaggccctg
ctccacagcgccaaccggccagaggacgagtgcgcgggtgagggcctggcctgctacccg
ctgtgtgcccacgggcactgctggggtgggggacccacccagtgtgtcaactgcagccag
ttccttcgaggccaggagtgtgtggnnnnnnnnngcaggggtacgcggggcagggcagga
ggggcggccggagtggggcacgggggctccttccagaccccctcctcagccatcccttct
gtcaggcttccccgggagtatgtgaaggataggttctgtctgccatgccacccagagtgt
cagccccagaatggctcagtgacctgcttgggctcggaagctgaccagtgtgtggcctgt
gcccactacaaggaccctcctttctgtgtggctcgctgccccagtggggtgaaacctgac
ctctccttcatgcccatctggaaatttgcagatgaggagggcacgtgccagccatgcccc
atcaactgcacccactcctgtgcggacctggacgagaagggctgccccgccgagcagaga
gccagccctgtgacgtccatcattgctgctgtggtgggcattctgctggtcgtggttgtg
gggctggtccttggcatcctaatcaagcgaaggcggcagaagatccggaagtacacgatg
cggaggctgctgcaggagacggagctggtggagcccctgacgcctagtggagccatgccc
aaccaggctcagatgcgaatcctgaaagaaacagagctgaggaaggtgaaggtgcttgga
tccggagcttttggcactgtctacaagggcatctggatccctgatggggaaaatgtgaaa
atcccagtggccatcaaagtgttgagggaaaatacatctcccaaagccaacaaagaaatc
ttggacgaagcgtatgtgatggctggcgtgggctccccatatgtgtctcgccttctgggc
atctgtctgacatccaccgtgcagttggtgacacagcttatgccttatggctgcctctta
gaccatgtccgagaacaccgtgggcgcctaggctcccaggacctgctgaaagattgccaa
ggtatgcacttagggggcctgagctctgcaggtgggatgagctacttggaggatgttcgg
ctcgtgcacagggacctggctgcccggaacgtgctggtcaagagtcccaaccacgtcaag
attacagattttgggctggctcggctgctggacattgacgagacagagtaccatgccgat
gggggcaaggtgcccatcaagtggatggcgctggagtccattctccgccggcggttcacc
catcagagtgacgtgtggagctacggtgtgactgtatgggaactgatgacttttggggcc
aaaccttatgatgggatcccagcccgggagattcctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaagggttggatg
atagactctgaatgtcggccacgtttccgggagttggtggctgaattctcccggatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggcccagccagtcccttg
gacagcactttctaccgttcactgctggaggatgaggacatgggagacctggtggacgct
gaggagtacctggtaccccagcagggtttcttctgcccagaccctgccccaggcgccggg
ggcacagcccaccacagacaccgcagctcatccaccaggagtggcggtggtgagctgaca
ctggggctggagccctccgaggaagagcctcccaagtctccactggcaccctcagaaggg
gctggctctgatgtgtttgatggcgacctgggaatgggggcagccaaggggctgcagagc
ctttccccacaggaccccagccctctacagcggtacagtgaggatcctaccgtaccccta
ccccctgagactgatggctacgttgcccccctgacctgcagtccccagcctgaatacgtg
aaccagccagaggtgtggccaaagcccccatcgcccttagaaggccctctgcctccttct
cgacctgccggtgccactctggaaaggcccaagactctgtcccccaaggctctttccccc
ggcaagaatggggttgtcaaagacgtttttgcctttgggggtgctgtggagaaccccgag
tacttggcaccccggggcagggctgcccctcagccccaccctcctccagccttcagccca
gcctttgacaacctctattactgggaccaggacacatctgagcggggctctccacccagc
acctttgaagggacccctacagcagagaaccccgaatacctgggcctggatgagacagtg
tga

DBGET integrated database retrieval system