KEGG   Panthera tigris altaica (Amur tiger): 102962052
Entry
102962052         CDS       T02988                                 

Gene name
CHAC1
Definition
(RefSeq) ChaC glutathione specific gamma-glutamylcyclotransferase 1
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102962052 (CHAC1)
Enzymes [BR:ptg01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     102962052 (CHAC1)
SSDB
Motif
Pfam: ChaC GGACT
Other DBs
NCBI-GeneID: 102962052
NCBI-ProteinID: XP_007081843
LinkDB
Position
Un
AA seq 314 aa
MPELGKPPPRLHHSCQICYRGGTEPISGRDGHRGSYSTGPAWPEGLKGASEGAAQLERPS
GARPGVRVRWSFRARAGDQPRRPPGXVPVPGTMKQESTAQNTPPASPPTSSPVQHPRDDG
DPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDH
EGCTWGVAYQVQGEQVSEALKYLNVREAVLGGYDTKEVTFYPQDNPDQPLKALAYVATPQ
NPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTM
LPCFCPTEQALALV
NT seq 945 nt   +upstreamnt  +downstreamnt
atgccggagctgggaaaacctcccccgcggttgcatcactcctgccagatttgctacaga
ggtggaaccgagccaatcagcgggcgagatgggcaccggggcagctactccacggggccc
gcctggccggagggtttaaaaggcgcttccgaaggggccgcgcagctggagcgaccaagc
ggtgccaggccaggtgtgcgcgtccgttggtccttccgtgcccgcgccggagaccagccc
cggaggccgccgggcntcgtccctgtgcccggcaccatgaagcaggagtccacagcccag
aacacccctcccgcctcgccgcccacttcgtcaccggtgcagcacccccgggatgacggt
gacccccaagccctgtggattttcgggtacggctctctcgtgtggaggcccgacttcgcc
tacagtgacagccgtgtgggtttcgtgcgcggctatagccgccgcttctggcagggagac
accttccatcggggcagcgacaagatgcctggccgtgtggtgaccctacttgaagatcat
gagggctgcacttggggtgtggcataccaggttcaaggtgagcaggtgagcgaggccctg
aagtacctgaacgtgcgggaggcagtgcttggtggctatgataccaaggaagtcaccttc
tacccccaagataaccctgaccaaccactcaaggcattggcttatgtggccaccccacaa
aatcctggttacctgggccctgcacctgaagaggccattgcaactcagatcctggcctgt
cgcggcttctctggtcacaacctcgagtacttgctacgcctggcagacttcatgcagctc
tgtgggccccaggcacaggatgagcacctggcagccatcgtggacgctgtgggcaccatg
ctgccctgtttctgccccactgagcaggctttggccctggtctga

KEGG   Panthera tigris altaica (Amur tiger): 102968625
Entry
102968625         CDS       T02988                                 

Gene name
CHAC2
Definition
(RefSeq) ChaC cation transport regulator homolog 2
  KO
K07232  glutathione-specific gamma-glutamylcyclotransferase [EC:4.3.2.7]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102968625 (CHAC2)
Enzymes [BR:ptg01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.7  glutathione-specific gamma-glutamylcyclotransferase
     102968625 (CHAC2)
SSDB
Motif
Pfam: ChaC GGACT
Other DBs
NCBI-GeneID: 102968625
NCBI-ProteinID: XP_007075473
LinkDB
Position
Un
AA seq 184 aa
MWVFGYGSLIWKVDFPYQDKLVGYITGYNRRFWQGSTDHRGVPGKPGRVVTLVEDPGGCV
WGVAYRLPVGKEEEVKAYLDFREKGGYRTTTVIFYPKDPTTKPFNVLLYIGTCDNPNYLG
PAPLEDIAEQIFNAAGPSGKNTEYLFELANSIRNIVPEDADEHLFSLEKLVKERLEGKQN
LNCL
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtgggtttttggttacgggtccctgatctggaaagtggacttcccctatcaggacaag
ttggttggatacatcacaggctacaacaggcgcttctggcaggggagcaccgaccaccgc
ggggtcccgggcaagcctggaagagttgtgactcttgttgaagatcctgggggttgtgta
tggggtgttgcttacagactgccagtaggaaaggaagaagaagtaaaagcataccttgac
ttcagagagaaaggaggctacaggaccacaacagtcattttttatccaaaagatcccaca
acaaaaccatttaatgtgttgctatatattggaacatgtgataatcctaattatcttggt
cctgcacctctggaagacattgctgaacaaatttttaatgcagctggtccaagtggaaaa
aatacagaatatctttttgaacttgcaaattctattaggaacattgtgccagaagatgca
gatgagcatcttttctctttggaaaaattagtgaaggaacgtttagaaggaaaacagaac
ctcaattgcttataa

DBGET integrated database retrieval system