KEGG   Panthera tigris altaica (Amur tiger): 102962124
Entry
102962124         CDS       T02988                                 

Gene name
IDH2
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 2, mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00020  Citrate cycle (TCA cycle)
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg01210  2-Oxocarboxylic acid metabolism
ptg01230  Biosynthesis of amino acids
ptg04146  Peroxisome
ptg05230  Central carbon metabolism in cancer
Module
ptg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102962124 (IDH2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102962124 (IDH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102962124 (IDH2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    102962124 (IDH2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     102962124 (IDH2)
SSDB
Motif
Pfam: Iso_dh Phe_ZIP
Other DBs
NCBI-GeneID: 102962124
NCBI-ProteinID: XP_007078286
LinkDB
Position
Un
AA seq 407 aa
MDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTVDSALATQKYSVAVK
CATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGR
HAHGDQYKATDFVVDRAGTFKIVFSPKDGSGAKEWEVFNFPAGGVGMGMYNTDESISGFA
HSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDD
MVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVT
RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTVESGAMT
KDLAGCIHGLSNVKLNEHFLNTSDFLDTGWGGSGPRLSLPAPLRRPL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggacggcgatgagatgacccggatcatctggcagttcatcaaggagaagctcatcctg
ccgcacgtggatgtccagctcaagtatttcgacctggggctcccaaaccgtgaccagacc
aacgaccaggtcaccgtagactccgcactggccacccagaagtacagtgtggctgtgaag
tgcgccaccatcacccccgatgaggcccgtgtggaagaattcaagctgaagaagatgtgg
aagagtcccaatggaaccatccgaaacatccttggggggaccgtcttccgggaacccatc
atctgcaaaaacatcccacgcctcgtccccggctggaccaagcccatcaccattggcagg
cacgcccatggcgaccagtacaaggccacagactttgtggtcgaccgggccggcacgttc
aagatcgtcttctccccgaaggatggcagtggcgctaaggagtgggaagtgttcaatttc
cctgccggcggcgtggggatgggcatgtacaacacggatgagtccatctcgggttttgcg
cacagctgcttccagtacgccatccagaagaagtggccgctgtacatgagcaccaagaac
accatcctgaaagcctacgacgggcgcttcaaggacatcttccaggaaatctttgacaag
cactataagaccgacttcgacaagaataagatctggtacgagcaccggctcatcgatgac
atggtggctcaggtcctcaagtcttcaggcggcttcgtgtgggcctgcaagaactacgac
ggagatgtgcagtcggacatcctggcccagggctttggctccctcggcctgatgacgtct
gtgctggtctgcccagatgggaagaccatcgaggctgaggccgctcacgggacggtcacc
cgccattatagggagcaccagaagggccggcctaccagcaccaaccccatcgccagcatc
tttgcctggacgcgtggcctggagcaccgggggaagctggatgggaaccaggacctcatc
aggtttgcacagaccctggagaaggtgtgtgtccagacggtggagagcggagccatgacc
aaggacctggcgggctgcatccatggcctcagcaacgtgaagctgaacgagcacttcctg
aacacctcggacttcctggacacggggtgggggggcagcgggccgcggctgagcctcccg
gcccctctcaggaggcctttgtag

KEGG   Panthera tigris altaica (Amur tiger): 102967152
Entry
102967152         CDS       T02988                                 

Gene name
IDH1
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00020  Citrate cycle (TCA cycle)
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg01200  Carbon metabolism
ptg01210  2-Oxocarboxylic acid metabolism
ptg01230  Biosynthesis of amino acids
ptg04146  Peroxisome
ptg05230  Central carbon metabolism in cancer
Module
ptg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ptg_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102967152 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102967152 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102967152 (IDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    102967152 (IDH1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     102967152 (IDH1)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 102967152
NCBI-ProteinID: XP_007089987
LinkDB
Position
Un
AA seq 414 aa
MSQKIRGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATGDQVTKDA
AEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTSSDGSKKMTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKSWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQNIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELSFFAKALE
EVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLNIKLAQAKL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtctcaaaaaatccgtggcggttctgtggtagagatgcaaggagatgaaatgacacga
atcatttgggagttgattaaagaaaaactcatttttccctacgtggaactggacctacac
agctatgatttaggcatagagaatcgcgatgccaccggtgaccaggtcaccaaggatgct
gcagaagctataaagaagtacaacgttggggtcaaatgtgctaccatcacccccgatgag
aagagggttgaggagttcaagttgaagcaaatgtggaagtcaccaaatggcaccatccga
aatattctgggcggcactgtcttcagggaagctatcatctgcaaaaatatcccccgtctt
gtgagcggttgggtaaaacctatcatcataggtcgtcatgcttatggggatcaatataga
gccactgattttgtcgttcctgggcctggaaaagtagagataacctacacgtcaagtgat
ggatccaaaaaaatgacatacctggtacataactttgaagaaggtggtggtgttgccatg
gggatgtacaatcaagataagtcgattgaagattttgcacacagttctttccagatggct
ctgtctaagagttggcctttgtatctgagcaccaaaaacactattctgaagaaatatgat
ggacgttttaaagacatctttcaggaaatatatgacaagcagtacaaatcccaattcgaa
gcccaaaatatttggtatgagcataggctcattgatgacatggtggcccaagctatgaaa
tccgaggggggcttcatctgggcctgtaagaactatgacggcgatgtgcagtcggactcc
gtggcccaaggttatggctcccttggcatgatgaccagcgtgctggtttgtccagacggc
aagacagtggaagcagaggctgcccatgggactgtaacacgtcactaccgcatgtatcag
aaaggacaagagacgtccaccaatcccattgcttccatttttgcctggaccagaggatta
gcccacagagctaagcttgataacaataaagagctcagcttctttgcaaaggctttggaa
gaagtctgtattgagaccattgaggctggcttcatgaccaaggacttggctgcttgtatt
aaaggtttgcccaacgtgcagcgttctgactacttgaatacgtttgagttcatggacaaa
ctcggagaaaacttgaatataaaactagctcaggccaaactttaa

DBGET integrated database retrieval system