KEGG   Panthera tigris altaica (Amur tiger): 102962166
Entry
102962166         CDS       T02988                                 

Gene name
NME6
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 6
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
Module
ptg_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ptg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102962166 (NME6)
   00240 Pyrimidine metabolism
    102962166 (NME6)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102962166 (NME6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102962166 (NME6)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     102962166 (NME6)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102962166 (NME6)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 102962166
NCBI-ProteinID: XP_007088519
LinkDB
Position
Un
AA seq 193 aa
MTSILRSPQALQLTLALIKPDAVAHPLILEAVHQQILSNKFLIVRMRELLWRKEDCQKFY
QEHEGRFFYQRLVEFMASGPIRAYILARKDAIQLWRTLMGPTRVFQARHVAPDSIRGSFG
LTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVRYSPEGGIHCAAGA
GDPGPACRRPVGL
NT seq 582 nt   +upstreamnt  +downstreamnt
atgacctcgatcttgagaagccctcaggctctccagctcactctggccctgatcaagcct
gatgcggttgctcaccccctgattctggaggctgttcatcagcagattctgagcaacaaa
ttccttattgtacgaatgagagaacttctgtggagaaaagaagattgccagaagttttac
caagaacacgaaggtcgttttttctatcagcggctggtggagttcatggccagtgggcca
atccgagcctacatccttgcccgcaaggatgccatccagctttggaggacactgatggga
cccaccagagtgtttcaagcacgtcacgtggctccagattcaattcgtggaagttttggc
ctcactgacacccgcaacacaacccatggctctgactctgtggtttcagccagtagagag
atcgcggccttcttccctgacttcagtgaacagcgctggtatgaggaagaggagccgcag
ctgcgctgtggccctgtgcgctatagtccagagggaggcatccactgcgcggccggagca
ggagacccgggaccagcctgccgcaggcctgtgggtctgtga

KEGG   Panthera tigris altaica (Amur tiger): 102963448
Entry
102963448         CDS       T02988                                 

Gene name
NME7
Definition
(RefSeq) NME/NM23 family member 7
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
Module
ptg_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ptg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102963448 (NME7)
   00240 Pyrimidine metabolism
    102963448 (NME7)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102963448 (NME7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102963448 (NME7)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     102963448 (NME7)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102963448 (NME7)
SSDB
Motif
Pfam: NDK ACT_5 DUF1126 Arg_repressor
Other DBs
NCBI-GeneID: 102963448
NCBI-ProteinID: XP_007077071
LinkDB
Position
Un
AA seq 368 aa
MNHGERFVFIAEWYDPNASLFRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDDLHLEDL
FIGNKVNVFSRQLVLIDYGDQYTARQLGSRKEKTLALIKPDAVSKAGEIIEMINKAGFTI
TKLKMMTLSRKEATDFHIDHQSRPFLNELIQFITSGPIIAMEILRDDAICEWKRLLGPAN
AGLARTDAPGSLRALFGTDGIRNAAHGPDSFASAARETELFFPSSGVCGPANTAKFTNCT
CCIIKPHAISEGLLGKILMAIRDAGFEISAMQMFNMDRVNVEEFYEVYKGVVSEYNEMVT
EMYSGPCVALEIQQNNPTKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLP
EDGLLEVR
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaatcacggggaaagattcgttttcattgccgagtggtatgatccgaatgcttcactt
tttcgacgttatgagcttttattttacccaggggatggatctgttgaaatgcacgatgtg
aagaatcaccgtacctttttaaagcggaccaaatatgatgatcttcacttggaagattta
tttataggcaacaaagtgaacgtcttttctcgacagctggtgctaattgactatggggat
caatacacagctcgccaactgggcagtaggaaagaaaaaacgttggctctgattaaacca
gatgcagtatcaaaagccggagaaataattgaaatgataaacaaagccggatttactata
accaaactcaaaatgatgacgctttcaaggaaagaagcaacagattttcatatagaccat
cagtcaaggccctttttaaacgagctgatccagtttattacgagtggtcctattattgcc
atggagattttaagagacgatgctatatgtgaatggaaaagactgctcggacctgcgaac
gctggtctggcacgtacggatgctcctgggagcctgagagccctctttggaaccgacggc
ataagaaatgcagctcatggccctgactcttttgcttctgctgccagagaaacggagtta
ttttttccttcgagtggagtttgtggacccgcaaacaccgctaaatttaccaattgcacc
tgttgcatcattaagccccatgctatcagtgaaggactcctgggaaagatcctcatggct
atccgggatgcaggttttgaaatctcagctatgcagatgttcaacatggatcgagttaac
gttgaagaattttatgaagtttataaaggagtagtgtctgagtataatgagatggtgaca
gaaatgtattccggcccttgtgtagcactggagattcaacagaataatcctacaaagaca
tttcgagaattctgtggaccagctgatcctgaaattgcccggcatttacgccctggaacg
ctcagagcaatctttggtaaaactaagatccagaacgctgtccactgtactgatctacca
gaggatggcctattagaggtaagataa

KEGG   Panthera tigris altaica (Amur tiger): 102967905
Entry
102967905         CDS       T02988                                 

Gene name
NME2
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 2
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
Module
ptg_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ptg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102967905 (NME2)
   00240 Pyrimidine metabolism
    102967905 (NME2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102967905 (NME2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102967905 (NME2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     102967905 (NME2)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102967905 (NME2)
SSDB
Motif
Pfam: NDK Benyvirus_14KDa
Other DBs
NCBI-GeneID: 102967905
NCBI-ProteinID: XP_007086750
LinkDB
Position
Un
AA seq 152 aa
MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKLIQASEDLLKEHYIDLKDRPF
FAGLVKYMQSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGS
DSVESVEKEIGLWFQPEELVDYKSCAQNWIYE
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccaacagcgaacgcaccttcattgccatcaagcctgatggggtccagcgcggcctc
gtgggagagatcatcaagcgttttgagcaaaagggattccgcctcgttgctatgaaatta
attcaggcttccgaagaccttctcaaggaacactacattgacctgaaggaccgtccattc
tttgccggcctggtgaagtacatgcaatcagggcctgtggttgccatggtctgggagggg
ctgaatgtggtgaagacaggccgggtgatgctgggagagaccaaccctgcggactccaag
cccgggaccatccgtggagacttttgcatccaagttggcaggaacatcatccatggcagt
gattccgtggaaagtgtggagaaggagattggcttgtggtttcagcctgaagagctggtg
gattacaagagctgtgctcagaactggatctacgagtga

KEGG   Panthera tigris altaica (Amur tiger): 102970480
Entry
102970480         CDS       T02988                                 

Gene name
NME4
Definition
(RefSeq) NME/NM23 nucleoside diphosphate kinase 4
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00240  Pyrimidine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
Module
ptg_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
ptg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102970480 (NME4)
   00240 Pyrimidine metabolism
    102970480 (NME4)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102970480 (NME4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102970480 (NME4)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     102970480 (NME4)
Membrane trafficking [BR:ptg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102970480 (NME4)
SSDB
Motif
Pfam: NDK
Other DBs
NCBI-GeneID: 102970480
NCBI-ProteinID: XP_007093714
LinkDB
Position
Un
AA seq 117 aa
MKMLQAPETVLAEHYHDLRRKPFYPALISYMTSGPVVAMVWEGPNVVCSSRAMIGHTNSA
EAAPGTIRGDFSVHISRNIVHASDSVEGAQREIQLWFQSSELVDWTEEGHQSSTYPA
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagatgctgcaggcgccagagacagtccttgccgagcactaccatgacctgcggagg
aagcccttctacccagccctcatcagctacatgacctccggccccgtggtggccatggtc
tgggaaggccccaacgtggtctgctcctcgagggccatgataggacacaccaactcagct
gaggctgcccccggcaccatcaggggggacttcagcgtccacatcagcaggaacatcgtc
cacgccagcgactccgtggagggggcccagagggagatccagctatggtttcagagcagt
gagctcgtggactggacagaagaaggccaccagagcagcacctacccagcctga

DBGET integrated database retrieval system