KEGG   Panthera tigris altaica (Amur tiger): 102962281
Entry
102962281         CDS       T02988                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    102962281
SSDB
Motif
Pfam: WAP Conotoxin_I2
Other DBs
NCBI-GeneID: 102962281
NCBI-ProteinID: XP_007073561
LinkDB
Position
Un
AA seq 160 aa
MRCLASLALVLLALEAAVALAAALAFTVPGQAMCPELSSLEEDSCVVSCSTDDDCPQGIR
CCPRSPCSRSXVFPVMAPLQKAGRCPRVPVPLAPEPCSESTECSVDSQCAGSRKCCFSTC
AMRCLDPATASVLDRRTEVFPAIPPLPQGETNPSQPGRGR
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcgctgtcttgccagcctggccctggtcctgctcgccctggaggctgccgtggccctg
gccgcggccctggccttcactgtgccagggcaggccatgtgcccggagctcagctccttg
gaggaggactcctgcgtcgtctcctgcagcaccgatgatgactgcccccaaggcatcaga
tgctgccccaggagcccctgcagccgctcctgagtgttccccgtcatggcacctttgcaa
aaggctggccgctgcccccgggtacccgtcccgctggcccccgagccctgctcagagagc
accgagtgctctgtggacagccagtgtgcagggagcaggaagtgttgcttcagcacatgc
gccatgcggtgtctggaccctgcgacagcaagcgtgttggacagaaggactgaggtcttc
ccagcaatccctcctctccctcaaggggagacaaacccatctcaaccagggaggggcaga

DBGET integrated database retrieval system