KEGG   Panthera tigris altaica (Amur tiger): 102962318
Entry
102962318         CDS       T02988                                 

Gene name
ANPEP
Definition
(RefSeq) alanyl aminopeptidase, membrane
  KO
K11140  aminopeptidase N [EC:3.4.11.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
ptg04614  Renin-angiotensin system
ptg04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102962318 (ANPEP)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102962318 (ANPEP)
  09152 Endocrine system
   04614 Renin-angiotensin system
    102962318 (ANPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ptg01002]
    102962318 (ANPEP)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102962318 (ANPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102962318 (ANPEP)
   04090 CD molecules [BR:ptg04090]
    102962318 (ANPEP)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.2  membrane alanyl aminopeptidase
     102962318 (ANPEP)
Peptidases and inhibitors [BR:ptg01002]
 Metallo peptidases
  Family M1
   102962318 (ANPEP)
Membrane trafficking [BR:ptg04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    102962318 (ANPEP)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102962318 (ANPEP)
CD molecules [BR:ptg04090]
 Proteins
  102962318 (ANPEP)
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1_N Peptidase_M1
Other DBs
NCBI-GeneID: 102962318
NCBI-ProteinID: XP_015391223
LinkDB
Position
Un
AA seq 903 aa
MAQGFYISKPVGILAILLGVAAVCTIIALSVVYSQEKNRSTESSTAASTAAPPGPTTTVA
TTLDQSKPWNVYRLPKTLIPDSYNVTLRPYLTPNDKGLYVFTGTSVVRFMCNESTSVVII
HSKRLNYTNHQGHMVSLSGVGGFQPQPVIVRTELVELTEYLVVHLQEPLVAGRQYEMKSE
FQGELADDLAGFYRSEYVENGIKKVLATTHMQATEARKSFPCFDEPAMKATFNITIIHPN
NLVALSNMLPRGPSVPFDGDRTWKVTEFETTPIMSTYLLAYIVSEFSYVETRAPSGVLIR
IWARPSAINQGHGDYALKVTGPILDFFSQHYDTPYPLNKSGQWFGNLVTLEWWNDLWLNE
GFASYVEYLGADFAEPTWNLKDLMVLNDVYHVMAVDALASSHPLSTPASEINTPAQISEV
FDSISYSWGAPALPSLRPVFPQSYLHTYKYGNTIYLNLWEHLQQVVDKQPTIKLPDTVSA
IMDRWILQMGFPVITVDTQTGTISQQHFLLDPQSVVTRPSQFNYLWIVPISSVRSGRPQE
HYWLPGVEKGNPAPPLWTAVPSPTPPAPGPHPGGSGRPQEVREGFLEEAIPVINRAQVIH
DAFNLASAQKVPVTLALNNTLFLIQETEYMPWQAALSSLSYFKLMFDRSEVYGPMKSYLK
KQVTPLFDHFERLTKNWTDHPQTLMDQYSEINAVSTACSYGVPKCEKLAVTLFAEWKKNP
QNNPIHPNLRSTVYCNAIAQGGEEEWNFVWEQFLKAELVNEADKLRGALACSNQVWILNR
FLSYTLDPNLIRKQDVTSTLSSISSNVVGQTLAWDFVQSNWKKLFQDYGTGSFSFSNLIQ
AVTRRFSTEFELQQLEQFKKNNMDTGFGSATRALEQALEKTKANIKWVKENKDVVLRWFT
ENS
NT seq 2712 nt   +upstreamnt  +downstreamnt
atggcccagggcttctacatttccaagcccgtgggcatcctggccatcctcctgggcgtg
gcggccgtgtgcaccatcatcgctctgtccgtggtgtactcccaggagaagaacaggagc
accgagagctccacggcggcctccacggcggcccccccgggccccaccaccaccgtggct
accaccttggaccaaagcaagccatggaacgtctaccgtctacccaagacgctgattccc
gactcctacaacgtgacgctgaggccctacctcacccccaacgataagggcctgtacgtc
ttcacgggcacaagcgtcgttcgcttcatgtgcaatgagtccaccagcgtcgtcatcatc
cacagcaagaggctcaactacaccaaccaccaggggcacatggtgtccttgtcgggcgtg
gggggcttccagccgcaacctgtcatcgtcaggacggagctggtggagctcaccgagtac
ctggtcgtgcacctccaggagccgctggtggccggcagacagtacgagatgaagagtgag
ttccagggggagctggccgacgacctggcgggcttctaccgcagcgagtacgtggagaac
ggcatcaaaaaggtgctggccacgacacacatgcaggctacagaggcccggaaatccttc
ccgtgctttgacgagcccgccatgaaggccacgtttaacatcaccatcatccaccccaac
aacttggtggccctgtccaacatgctgcccagaggccccagcgtcccgtttgatggagat
cgcacctggaaagtcaccgagttcgaaaccacacccataatgtctacttacctgctggcc
tacatcgttagtgagttctcatatgtggagacaagagctcccagtggcgtcctgatccgg
atctgggcccggcccagtgcgatcaaccagggccatggcgattatgccctgaaggtgaca
ggccccatcctggacttcttttcccaacattacgacacgccctacccgctcaacaaatcg
ggacagtggtttgggaacctggtgaccttggagtggtggaatgacctatggctgaacgag
ggcttcgcctcctacgtggagtacctaggtgctgactttgcagagcccacgtggaatttg
aaagacctcatggtgctgaacgacgtgtaccatgtgatggctgtggacgccctggcctcc
tcccacccgctgtcaactcctgcctcggagatcaacacgccggcccagatcagcgaggtg
tttgactccatctcttacagctggggagcaccggctttgccctcactgcgacctgtcttt
ccacagtcctacctccatacctataaatacgggaacaccatctacctgaacctgtgggag
cacctgcagcaggttgtagacaaacagccgaccatcaagctgcccgacaccgtgagtgcc
atcatggaccgctggatcctgcagatgggcttccccgtcatcaccgtggacacccagaca
ggcaccatctcccagcagcacttcctccttgacccccagtccgtggtcacccgcccctca
cagttcaactacctgtggatcgttcccatctcttctgtcagaagcggcagaccgcaggag
cactactggctgccgggcgtcgaaaaaggtaatccagccccgcccttgtggacagccgtc
ccctcccccacacccccagctcccggcccacatcctgggggttccggcaggcctcaagag
gtgagggaaggcttcctggaggaggccattcctgtcatcaaccgggctcaagtcatccac
gatgccttcaacctggcgagtgcccaaaaggtccctgtcactctggcgctgaacaacact
ctcttcctgatccaagagaccgagtacatgccctggcaggccgccctgagcagcctgagc
tactttaagctcatgttcgaccgctctgaggtctacggccccatgaagagctacctgaag
aagcaggtcacgcccctcttcgatcatttcgaaagactcaccaaaaactggactgatcac
ccgcaaaccctcatggaccagtacagcgagattaacgccgtcagcaccgcctgctcctac
ggggttcctaagtgtgagaagctggccgtgactcttttcgccgagtggaagaagaacccc
caaaacaacccgatccaccccaacctgcggtccaccgtgtactgcaatgccatcgcccag
ggcggcgaggaggagtggaacttcgtgtgggagcagttcctaaaggccgaactggtgaac
gaggctgacaaactccgcggagccctggcctgcagcaaccaggtctggatcctgaacagg
ttcctgagttataccctggaccctaacctcatccggaaacaagatgtcaccagcactctc
agcagcatctccagcaacgtcgtcgggcaaaccctggcctgggactttgtccagagcaac
tggaagaaactctttcaggactatggcactggttccttctccttctccaacctcatccag
gcagtgacccgacgattctccactgagttcgagctgcagcagctggagcagttcaagaag
aacaacatggacacaggcttcggctcagccacccgagctctggagcaagccctggagaag
accaaagccaacatcaagtgggtgaaggagaacaaggatgtggtgctcaggtggttcaca
gaaaacagctaa

DBGET integrated database retrieval system