KEGG   Panthera tigris altaica (Amur tiger): 102962570
Entry
102962570         CDS       T02988                                 

Gene name
IRAK4
Definition
(RefSeq) interleukin 1 receptor associated kinase 4
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04620  Toll-like receptor signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05135  Yersinia infection
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05161  Hepatitis B
ptg05162  Measles
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102962570 (IRAK4)
   04064 NF-kappa B signaling pathway
    102962570 (IRAK4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102962570 (IRAK4)
   04621 NOD-like receptor signaling pathway
    102962570 (IRAK4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102962570 (IRAK4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102962570 (IRAK4)
   05135 Yersinia infection
    102962570 (IRAK4)
   05133 Pertussis
    102962570 (IRAK4)
   05152 Tuberculosis
    102962570 (IRAK4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102962570 (IRAK4)
   05161 Hepatitis B
    102962570 (IRAK4)
   05171 Coronavirus disease - COVID-19
    102962570 (IRAK4)
   05164 Influenza A
    102962570 (IRAK4)
   05162 Measles
    102962570 (IRAK4)
   05168 Herpes simplex virus 1 infection
    102962570 (IRAK4)
   05169 Epstein-Barr virus infection
    102962570 (IRAK4)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102962570 (IRAK4)
   05140 Leishmaniasis
    102962570 (IRAK4)
   05142 Chagas disease
    102962570 (IRAK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102962570 (IRAK4)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102962570 (IRAK4)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: TKL group
  IRAK family
   102962570 (IRAK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Death Kdo
Other DBs
NCBI-GeneID: 102962570
NCBI-ProteinID: XP_007072986
LinkDB
Position
Un
AA seq 460 aa
MNKPITSSTYVRSLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALL
QTGKSPTCELLFDWGTTNCTVGDLVDLLVQNEFFAPASLLLPDAVPQTVNTLPAKEAVTV
PQKELPLCGKDRTFVLPVQDLEQNYVPPDSSSPENTSLAESDTRFHSFSFYELKNVTNNF
DERPISVGGNKMGEGGFGVVYKGCVNNKTVAVKKLAAMVDISTEELKQQFDQEIEVMAKC
QHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDDTPPLSWHMRCKIAQGAATGIS
FLHENHHIHRDIKSANILLDEDFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEAL
RGEITPKSDIYSFGVVLLEIITGLPAVDEYREPQLLLDIKEEIEDEEKTIEDYIDTKMND
IDPISIETMYSVASQCLHEKKNKRPDIKKVQQLLQEMTVS
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaataaacccataacatcttcaacatatgtgcgctccctcaatgttggactaatcagg
aagctgtcagattttattgatcctcaagaaggatggaagaagttagcggtagctattaaa
aaaccatctggtgatgatagatacaatcagtttcacataaggagatttgaagcattactt
caaactggaaaaagccccacttgtgaattactgtttgactggggtaccacaaattgcaca
gttggtgatcttgtggatcttttggtccaaaatgagttttttgccccagcaagtcttttg
ctaccagatgctgttccccaaactgttaatacactacctgctaaagaagctgtaacagtt
cctcagaaagaattgcctctctgtggcaaagacaggacatttgtgttacctgtgcaggat
cttgaacaaaactatgtgccccctgactcctcaagtccagaaaatacaagtttagcagag
agtgatacacgttttcacagcttttcattttatgaattgaagaatgtcacaaataacttt
gatgaaaggcccatttctgtcggtggcaacaagatgggagagggcgggtttggagttgtg
tataaaggctgcgtgaacaacaaaactgtagcagtgaagaagcttgcagcaatggttgac
attagtactgaagaactgaaacagcagtttgatcaagaaatagaagttatggcaaagtgt
caacatgaaaacttagtagaactacttggtttctcaagtgacggagatgacctctgctta
gtgtatgtttacatgcccaatggctcattgctggacaggctgtcctgcttggatgatact
ccaccactttcttggcatatgagatgcaagattgctcagggtgcagctactggcatcagt
tttttacatgaaaaccatcatattcatagagacattaaaagtgcaaatatcttactagat
gaagactttacagccaaaatatcagactttgggcttgcacgggcttctgagaagtttgcc
caaacagtcatgactagcagaattgtgggaacaacagcttatatggcacctgaggcttta
cgaggagaaataacacccaaatctgacatatacagctttggtgtggttttattagaaata
ataactggacttccagctgtagatgaataccgtgaacctcagttattgctagatattaaa
gaagaaatcgaagatgaagaaaagacaattgaagattatattgatacgaagatgaatgac
attgatcccatttccattgaaaccatgtattctgttgccagtcaatgcttgcatgaaaag
aaaaataagagaccagatattaagaaggttcaacagctgctgcaagaaatgacagtttct
tga

DBGET integrated database retrieval system