KEGG   Panthera tigris altaica (Amur tiger): 102962571
Entry
102962571         CDS       T02988                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04010  MAPK signaling pathway
ptg04071  Sphingolipid signaling pathway
ptg04110  Cell cycle
ptg04115  p53 signaling pathway
ptg04137  Mitophagy - animal
ptg04151  PI3K-Akt signaling pathway
ptg04210  Apoptosis
ptg04211  Longevity regulating pathway
ptg04216  Ferroptosis
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04722  Neurotrophin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05217  Basal cell carcinoma
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102962571 (TP53)
   04310 Wnt signaling pathway
    102962571 (TP53)
   04071 Sphingolipid signaling pathway
    102962571 (TP53)
   04151 PI3K-Akt signaling pathway
    102962571 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102962571 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    102962571 (TP53)
   04210 Apoptosis
    102962571 (TP53)
   04216 Ferroptosis
    102962571 (TP53)
   04115 p53 signaling pathway
    102962571 (TP53)
   04218 Cellular senescence
    102962571 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102962571 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    102962571 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    102962571 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102962571 (TP53)
   05202 Transcriptional misregulation in cancer
    102962571 (TP53)
   05206 MicroRNAs in cancer
    102962571 (TP53)
   05205 Proteoglycans in cancer
    102962571 (TP53)
   05203 Viral carcinogenesis
    102962571 (TP53)
   05230 Central carbon metabolism in cancer
    102962571 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102962571 (TP53)
   05212 Pancreatic cancer
    102962571 (TP53)
   05225 Hepatocellular carcinoma
    102962571 (TP53)
   05226 Gastric cancer
    102962571 (TP53)
   05214 Glioma
    102962571 (TP53)
   05216 Thyroid cancer
    102962571 (TP53)
   05220 Chronic myeloid leukemia
    102962571 (TP53)
   05217 Basal cell carcinoma
    102962571 (TP53)
   05218 Melanoma
    102962571 (TP53)
   05219 Bladder cancer
    102962571 (TP53)
   05215 Prostate cancer
    102962571 (TP53)
   05213 Endometrial cancer
    102962571 (TP53)
   05224 Breast cancer
    102962571 (TP53)
   05222 Small cell lung cancer
    102962571 (TP53)
   05223 Non-small cell lung cancer
    102962571 (TP53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    102962571 (TP53)
   05014 Amyotrophic lateral sclerosis
    102962571 (TP53)
   05016 Huntington disease
    102962571 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102962571 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102962571 (TP53)
   05161 Hepatitis B
    102962571 (TP53)
   05160 Hepatitis C
    102962571 (TP53)
   05162 Measles
    102962571 (TP53)
   05168 Herpes simplex virus 1 infection
    102962571 (TP53)
   05163 Human cytomegalovirus infection
    102962571 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102962571 (TP53)
   05169 Epstein-Barr virus infection
    102962571 (TP53)
   05165 Human papillomavirus infection
    102962571 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102962571 (TP53)
   01522 Endocrine resistance
    102962571 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102962571 (TP53)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102962571 (TP53)
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102962571 (TP53)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102962571 (TP53)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102962571 (TP53)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102962571 (TP53)
SSDB
Motif
Pfam: P53 P53_tetramer CEP1-DNA_bind DEC-1_N
Other DBs
NCBI-GeneID: 102962571
NCBI-ProteinID: XP_015397303
LinkDB
Position
Un
AA seq 291 aa
FRLPENNVLSSELSSAMNELPLSEDVANWLDEAPDDASGMSAVPAPAAPAPATPAPAISW
PLSSFVPSQKTYPGAYGFHLGFLQSGTAKSVTCTVSGPEGPVSRPYPRPRAVCTASRVIP
NPRLRKPAYTLQACLALGGLTRPDRLSQVGSDCTTIHYNFMCNSSCMGGMNRRPIITIIT
LEDSNGKLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCPEPPPGSTKRVLPPSTSSTP
PQKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQSGKEPGGSRAHSR
NT seq 876 nt   +upstreamnt  +downstreamnt
ttcagacttcccgaaaacaatgttctgtcttccgagctgtcctcggcgatgaatgagctg
ccgctctcggaagatgtcgcaaactggttggatgaagcgccagatgatgcttccggaatg
tcagcggttccggcaccagcagcccctgcgccagccacccctgcgccagccatctcctgg
cccctgtcatcctttgtcccttcgcagaagacctacccgggcgcctatggtttccattta
gggttcctgcagtcggggacagccaagtctgttacttgcacggtcagtggccctgagggg
ccggtttccaggccgtacccacggccgcgtgcggtgtgcaccgccagccgggtgatcccc
aatccacggttgaggaaaccagcctacacactgcaggcctgcctggcgctgggtggcctc
actcggcccgatcgtctctcccaggtcggctctgactgtaccaccatccactacaatttc
atgtgtaacagttcctgcatggggggcatgaaccggaggcccatcatcaccatcatcacc
ctggaagactccaatgggaagctgctgggacggaacagcttcgaggtacgagtttgtgcc
tgtcctgggagagaccggcgcacggaggaggaaaatttccgcaagaagggggagccttgc
cctgagccgccccctgggagcactaagcgagtgctgccccccagcaccagctctactccc
ccacaaaagaagaagccactggatggagaatatttcacccttcagatccgtgggcgtgaa
cgcttcgagatgttccgagagctgaatgaggccttggagctgaaggatgcccagagtggg
aaggagccaggcggaagcagggctcactccaggtga

DBGET integrated database retrieval system