KEGG   Panthera tigris altaica (Amur tiger): 102962954Help
Entry
102962954         CDS       T02988                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01524  Platinum drug resistance
ptg05200  Pathways in cancer
ptg05204  Chemical carcinogenesis
ptg05225  Hepatocellular carcinoma
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102962954 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102962954 (MGST2)
   00982 Drug metabolism - cytochrome P450
    102962954 (MGST2)
   00983 Drug metabolism - other enzymes
    102962954 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102962954 (MGST2)
   05204 Chemical carcinogenesis
    102962954 (MGST2)
   05225 Hepatocellular carcinoma
    102962954 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102962954 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    102962954 (MGST2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102962954 (MGST2)
Transporters [BR:ptg02000]
 Other Transporters
  Pores ion channels [TC:1]
   102962954 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 102962954
NCBI-ProteinID: XP_007091849
UniProt: A0A060KZN7
LinkDB All DBs
Position
Un
AA seq 146 aa AA seqDB search
MAGHSILLAAVSVLSACQQSYFALHVGKARLKYKVTPPAVSGSPEFERIFRAQQNCVEFY
PIFLITLWMAGWYFNQVFATCLGLVYIYARHQYFWGYSEAAKKRITGFRLSLAILALLTV
LGTLGIANSFLDEYMDLNVAKKLRRF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcattcaatcttgctggccgctgtctcagtcttgtccgcctgtcaacaaagt
tattttgctttgcatgtaggaaaggcaagattaaaatacaaagttacacccccagcagtc
tctgggtcaccagagtttgagagaatatttcgtgcacaacaaaactgtgtggagttttac
cccatatttctgattacattgtggatggctggatggtatttcaatcaagtttttgctacc
tgtctgggtctggtgtacatatatgcccgtcaccagtatttctggggatattcagaagca
gctaaaaaaaggatcaccgggttccggctgagtctggcgattctggccttgctgacagtc
ctgggcaccctggggattgcaaacagctttctggatgaatacatggacctcaatgtcgcc
aagaaactgagacgcttctaa

DBGET integrated database retrieval system