KEGG   Panthera tigris altaica (Amur tiger): 102963113
Entry
102963113         CDS       T02988                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04151  PI3K-Akt signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05140  Leishmaniasis
ptg05200  Pathways in cancer
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102963113 (IL4)
   04151 PI3K-Akt signaling pathway
    102963113 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102963113 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102963113 (IL4)
   04660 T cell receptor signaling pathway
    102963113 (IL4)
   04658 Th1 and Th2 cell differentiation
    102963113 (IL4)
   04659 Th17 cell differentiation
    102963113 (IL4)
   04657 IL-17 signaling pathway
    102963113 (IL4)
   04664 Fc epsilon RI signaling pathway
    102963113 (IL4)
   04672 Intestinal immune network for IgA production
    102963113 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102963113 (IL4)
  09163 Immune disease
   05310 Asthma
    102963113 (IL4)
   05320 Autoimmune thyroid disease
    102963113 (IL4)
   05321 Inflammatory bowel disease
    102963113 (IL4)
   05330 Allograft rejection
    102963113 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    102963113 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102963113 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102963113 (IL4)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102963113 (IL4)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Haparin
  Cytokines
   102963113 (IL4)
SSDB
Motif
Pfam: IL4 FAD_SOX
Other DBs
NCBI-GeneID: 102963113
NCBI-ProteinID: XP_007087828
LinkDB
Position
Un
AA seq 133 aa
MDLTSQLIPALVCLLAFTSTFVHGQNFNNTLKEIIKTLNILTARNDSCMELTVMDVLAAP
KNTSDKEIFCRATTVLRQIYTHHNCSTKFLKGLDRNLSSMANRTCSVNEVKKSTLKDFLE
RLKAIMQKKYSKQ
NT seq 402 nt   +upstreamnt  +downstreamnt
atggatctcacctcccaactgattccagctctggtctgcttactagcatttaccagcacc
ttcgtccacggccagaacttcaataatacgttgaaagagatcatcaaaacgttgaacatc
ctcacagcgagaaacgactcgtgcatggagctgactgtcatggacgtcttggcagcccca
aagaacacaagtgacaaggaaatcttctgcagagccacaaccgtgctccggcagatctat
acacaccacaactgctccaccaaattcctcaaaggactcgacaggaacctcagcagcatg
gcaaacaggacctgttctgtgaatgaagtcaagaagagtacactgaaagacttcttggaa
aggctaaaagcgatcatgcaaaagaaatactcaaagcaatga

DBGET integrated database retrieval system