KEGG   Panthera tigris altaica (Amur tiger): 102963393Help
Entry
102963393         CDS       T02988                                 

Gene name
RFXANK
Definition
(RefSeq) regulatory factor X associated ankyrin containing protein
  KO
K08062  regulatory factor X-associated ankyrin-containing protein
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04612  Antigen processing and presentation
ptg05152  Tuberculosis
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102963393 (RFXANK)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102963393 (RFXANK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102963393 (RFXANK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank_3 Ank Ank_4
Motif
Other DBs
NCBI-GeneID: 102963393
NCBI-ProteinID: XP_007088438
LinkDB All DBs
Position
Un
AA seq 260 aa AA seqDB search
MEPTQPAEDLSLTQQLPIPEFGDPEDPSDEAPDGSDTVVLSLFPCTLEPGNPEPDAGASS
PQGGSSLKHSTTLTNRQRGNEVSALPATLDSLSIHQLAAQGELSQLKEHLRKGDNLINKP
DEHGFTPLIWASAFGEIETVRFLLEWGADPHILAKERESALSLASMGGYTDIVGLLLERD
VDINIYDWNGGTPLLYAVRGNHVKCVEALLARGADLTTEADSGYTPMDLAVALGYRKVQQ
VIENHILKLFQSNLVPADPE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggagcccacccagccggcagaggacctcagtctgacccaacagctccccatcccagaa
tttggggaccctgaggaccccagcgatgaggcccccgatggctcagacactgtggtgctc
agtctcttcccctgcactctggagcctgggaatcctgaaccggatgctggtgcctcctca
ccgcagggaggcagctccctgaagcactccacaaccctcaccaaccggcagcgggggaac
gaggtttcggccctgccagccaccctcgactccctgtccatccaccagctcgcggcccag
ggggagctgagccagctgaaggagcatctgaggaaaggcgacaacctcatcaacaagccg
gacgagcatggcttcacccccctcatctgggcctccgcctttggagaaatcgagactgtc
cgcttcttgctcgagtggggtgctgacccccacatcctggccaaggaacgggaaagcgcc
ctgtccctggccagcatgggcggctacacagacattgtagggctgttacttgagcgtgat
gtggacatcaacatctacgactggaatggagggacgccactgctgtacgccgtgcgtggg
aaccacgtgaagtgcgtagaagccttgttggcccgaggagccgatctcaccactgaggct
gactccggctataccccaatggaccttgccgtggccctgggatatcggaaagtgcaacag
gtgatcgagaaccacatcctcaaactcttccagagcaacctggtgcccgcagatcctgag
tga

DBGET integrated database retrieval system