KEGG   Panthera tigris altaica (Amur tiger): 102963503Help
Entry
102963503         CDS       T02988                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00052  Galactose metabolism
ptg00500  Starch and sucrose metabolism
ptg01100  Metabolic pathways
ptg04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102963503 (MGAM)
   00500 Starch and sucrose metabolism
    102963503 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102963503 (MGAM)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102963503 (MGAM)
    3.2.1.20  alpha-glucosidase
     102963503 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102963503
NCBI-ProteinID: XP_015396940
LinkDB All DBs
Position
Un
AA seq 1825 aa AA seqDB search
MARKKLKYFTSLELMLSVLLLVVFIITIPLFVLSAMDSSESKDPETTSTTPGSAECPVVN
EVERINCIPDQPPTKATCDQRGCCWRPQGTISVPWCYYSKSHGYQMEGDLVKTNAGFTAQ
LDRLPSPSLFGNDVNSVLLTAEYQTANRFHFKLTDQSKDRYEVPHEHVQPFKGNAASPLT
YEVVVSKQPFSINVIRRSNNRVLLDSSIGPLLFADQFLQFSTRLPSPNVYGLGEQVHRQY
RHDMNWKTWSMFARDTIPNGDGTNLYGTQTFFLCLEDASGLSFGVFLMNSNAMEVALQPA
PAVTYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYDYGTLQSMR
EVVERNRAAQLPYDVQHADIDYMDERKDFTYDPVNFKGFPEFVKELHNNGQKLVIIVDPA
ISNNSSPSNPYSPYDRGSDAKIWVNVSDGVTPLIGEVWPGKTVFPDYTNPNCAVWWAKEF
ELFYKQVEFDGIWIDMNEVSNFVDGSVSGCSTSNLNYPPFTPRILDGYLFCRSLCMDAVQ
HWGKQYDVHNLYGYSMAIATTQAVKTVFPNKRSFIITRSTFAGSGKFAAHWLGDNAATWN
DLRWSIPGMLEFNLFGIPMVGADICGFALDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQ
DPASFGATSLLLNSSRHYLTIRYTLLPYLYTLFYWAHSRGDTVARPLLHEFYRDSNTWDV
HQQFLWGPGLLITPVLEEGAEKVMAYMPDAIWYDYETGARMRWRKQRVEMELPGDKIGLH
LRGGHVFPTQQPATTTVVSRRNPLGLIIALDENKEAKGELFWDDGETKDTVASKIYLLCE
FSVTQNRLDVKILQSTYKDPNNLVFKEIKILGIQEPNNVIVKHNGVPSQISPNVTYDSNL
QVALITELDLVLGEAYTVEWGLKIRDAEKIDCYPDESGASAENCAARGCAWEAPSSPGVP
FCYFVNDLYSVGDIQYDSRGATATVSLKSSLYASALPSVPVTSLRVQVTYHKNDMVQFKI
YDPNNNRYEVPVPLNIPRVPSSTTEGQLYDVLIKKNPFGIEIRRKSTGSVIWDSQLLGFT
FNDMFIRISTRLPSQYVYGFGETEHTAFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYM
ALEQDGSAHGVLLLNSNAMDVTFQPLPALTYRTIGGILDFYVFLGPTPELVTQQYTELIG
RPVMVPYWALGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPK
FAGFPALITRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKAPNGGGIVWGKV
WPDFPNVVVNGSLDWESQVEQYRAYVAFPDFFRNSTATWWKREMRELYTNPRDPEKSLKF
DGMWIDMNEPASFVNGAVPPGCKDATLNHPPYMPHLESRDLGLSSKTLCMESQQILPDGS
RVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWAGHWLGDNTAAWDQL
KKSIIGMLEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNTIGTRRQDP
VSWDATFVNISRSVLKTRYTLLPYLYTLMHMAHTEGSTVVRPLLHEFVSDRVTWDVDRQF
LLGPAFLVSPVLEANARNVTAYFPRARWYDYYTGVDIKARGEWKALLAPLDHINLHVRGG
FILPWQEPAQNTHLSRQKFIGFKVALDDEGTAKGWLFWDDGQSIDTYGKGLYYLANFSAS
QNTMQSHIIFNKYITDTNPLKLGYVEIWGVGSVPISSVSISASGMVIRPTFTYNPASQVL
SIDMTSIDISLHKFVSLTWRSTLNF
NT seq 5478 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaatatttcacgagtttggagcttatgctcagtgttcttctg
cttgtggtgtttatcatcactattcctctgtttgtgctttcagccatggattcttcagaa
tctaaagatcctgagacaacgagtaccaccccgggttctgctgagtgcccagtggtcaat
gaagtggaacggataaactgcatccctgaccagccaccaacaaaggccacatgtgatcag
cgtgggtgctgctggagaccacaggggaccataagtgtgccctggtgctactattctaaa
agccatggttatcaaatggagggtgaccttgtaaaaacaaatgcaggattcacagcccag
ttggacaggttgccttctccatccctgtttggaaatgatgtcaacagtgtccttctcaca
gcagaataccagacagccaaccgtttccactttaagttgaccgaccagagcaaggacagg
tacgaagtgccccatgaacatgtgcaacccttcaaaggaaatgctgcttctcctttgacc
tatgaggttgttgtctccaaacagccatttagcatcaacgtgatcagaagaagcaataat
cgtgtcctgttggactcaagcattggacccctcctgtttgccgatcagttcctgcagttc
tccacccgactgcccagtcctaacgtgtatggtctgggagaacaggtgcaccgacagtac
cggcatgacatgaattggaagacctggtccatgtttgccagggacacaatccccaatggg
gatggaactaacttgtatggtacacagacattcttcctgtgtcttgaagatgctagcgga
ttgtcctttggagtgtttctgatgaatagcaatgccatggaggttgccctccagcccgcc
ccagctgtcacttaccgcaccattggaggcatcctcgacttctatgtgtttttgggaaac
actccagagcaagttgttcaagaatatctagagctcattggacggccagcccttccctca
tactgggcacttggatttcatctcagtcggtatgattatggaaccctacagagcatgaga
gaagtcgtggagagaaaccgtgccgcacagcttccttatgatgttcagcatgctgatatt
gattatatggacgagaggaaggacttcacttatgacccagtaaattttaaaggcttccct
gagtttgtgaaggagttacacaataacggacagaaattggtcatcattgtggatccagcc
atctccaacaactcttccccaagcaatccctatagcccgtatgacaggggttcagatgcg
aagatatgggtgaatgtttcagatggggtgactccactcattggggaggtctggcctgga
aaaactgtgtttcctgattataccaaccccaactgtgctgtttggtgggcaaaggaattt
gagcttttctacaagcaagtggagtttgatggaatctggattgatatgaatgaagtttcc
aacttcgttgatggttctgtttcaggatgttccacgagcaacctaaattaccccccattc
actcccagaatcctggatgggtacctgttctgcaggagcctctgcatggatgcagtgcag
cactggggcaagcagtacgatgtccacaatctgtacggctactccatggcgattgccacc
acacaagctgtcaagactgtgttccctaataagagaagcttcattataacccgttcgacc
tttgcgggatctggcaagtttgcagcccattggttaggagacaacgcagccacctggaat
gatctccggtggtctatccctggcatgctcgagttcaacctttttggtatcccaatggtc
ggtgctgacatatgtggctttgcattggatgcccctgaggagctctgcaggcggtggatg
cagctgggagcgttttatccattttccaggaatcacaatggccaaggctacaaggcccag
gatcctgcctcctttggagctacctccctgctactgaattcctccaggcactaccttacc
atccgctacaccctgttaccctacctctataccctcttctattgggcccacagccggggg
gacacggtggccaggccccttctgcatgagttctacagggacagcaacacgtgggatgta
caccaacagtttttatggggacctgggctccttatcactccagttctggaagagggtgca
gagaaggtgatggcttatatgcccgatgccatctggtatgattacgagactggggcccga
atgagatggaggaagcaaagagtggagatggaacttcctggagacaaaatcggactccac
cttcgcggaggccatgtattccccacacaacagcccgccaccaccactgtggtcagtcga
cggaaccctcttggtctcatcatcgccctagatgagaacaaagaagccaaaggcgaactt
ttctgggatgatggggaaactaaagatactgtggccagtaaaatctatctcttatgtgag
ttttctgtcacccaaaaccgcttggatgtgaagattttgcagtcaacctacaaagacccc
aataatttagtatttaaagagattaaaattcttgggatccaggagcctaacaatgttata
gtgaaacacaatggtgtcccaagtcagatttctcctaatgtcacttatgattctaaccta
caggtcgcccttatcacggaacttgatcttgtcctgggagaagcatacacagtggagtgg
ggcctgaagataagggatgcagaaaaaatagactgttatcccgatgagagtggtgcttct
gcagaaaactgtgctgcccgtggctgtgcctgggaggcacctagttctcctggggtccca
ttttgttatttcgtcaatgacctgtactctgtcggcgacattcaatacgactcacgtggc
gccactgctaccgtctcattaaagtcttctttatatgcctccgctctgccctcggtaccc
gtgacctccctccgtgtgcaagtgacctaccataagaacgacatggtgcagtttaagatt
tatgatcctaacaacaatcggtatgaagtcccggtgcctctcaacatacccagggttcca
tccagcaccacagagggtcagctgtatgatgtcctcatcaagaagaatccgtttgggatt
gaaattcgccggaagagtacgggctctgtaatttgggactctcagctcctcggctttacc
ttcaatgacatgttcatccgcatctccactcgccttccctcccaatacgtctatggcttt
ggggaaactgagcacacagcctttcggagagacttgaactggcacacgtgggggatgttc
tcccgagaccaacccccagggtacaagaagaattcctatggcgtccacccctactacatg
gcactggagcaggatggcagtgcccatggagtgctcttgctaaacagcaatgccatggat
gtgacattccagcccctgcccgccttgacgtaccgcaccatagggggaattctggacttt
tatgtgttcttggggccaactcccgagcttgtcactcagcagtatactgagttgatcggt
cggccagtgatggttccttactgggccttgggatttcagctgtgtcgctatggataccag
aatgactctgagatcgccagcttgtatgatgagatggtggctgcccagattccttatgac
gttcagtactcagacatcgactacatggagcggcagctggacttcaccctcagccccaag
tttgcgggatttccagctctgatcactcgcatgaaggccgacgggatgcgggtcatcctt
attctggacccagccatttctgggaatgagacacagccctatcctgcattcacccggggt
gtggaggatgatgtcttcatcaaagctccaaatggtggcggcattgtctggggaaaggtg
tggcctgatttccctaatgtcgttgtaaacgggtctctagactgggaaagtcaagtcgag
caataccgagcttacgtggccttcccagactttttccgtaattcaactgccacatggtgg
aagagggagatgcgagaactatataccaatccacgggatccagagaagagcttgaagttt
gatggcatgtggattgatatgaatgagccggcgagttttgtgaatggagcagtgccccca
ggctgcaaggacgccactctgaaccaccctccctatatgccacatttggagtccagggac
ctgggccttagcagcaagaccctgtgcatggagagtcagcagatcctgccagatggctca
cgggtgcgacactatgacgtgcacagcctgtacggatgggcccagaccagacccacctac
gaagctgtgcaggaggtgacgggacagagagggattgtcatcacccgctccacattcccc
tcttctggccgctgggcaggtcactggctgggagacaacacagctgcctgggaccagctg
aagaagtctatcattggcatgttggagttcagcctctttggcatatcttatacaggagca
gatatttgtggattctttcaagatgctgaatatgagatgtgtgctcgctggatgcaactg
ggggccttttaccccttctcgaggaaccacaacaccattgggaccaggaggcaagaccct
gtgtcctgggatgcaacctttgtgaatatctccagaagtgtcctgaagaccagatatacc
ctgctgccatatctctacaccctgatgcacatggcccacacggagggcagcactgtcgtc
cggcctcttctccatgagttcgtgtcagaccgggtgacctgggatgtggaccgtcagttt
ctgctgggcccagccttcctggtcagccctgtcctggaggctaatgcccgaaacgtcact
gcatatttccccagagcccgctggtatgattactacacgggtgtggacatcaaagcaagg
ggagaatggaaggccttgctggcccctcttgaccacattaatctacatgtccgtgggggc
ttcatcctgccctggcaagagcctgcacagaacacccacttaagccgtcagaaattcatt
ggcttcaaggttgccttggatgatgaggggactgctaaaggttggctcttctgggatgat
gggcaaagcattgatacctatggaaaaggactctattacctggccaacttttccgccagc
caaaatacgatgcagagtcatataattttcaacaaatatatcaccgatacaaatcctttg
aaactgggctacgtggagatctggggagtgggcagcgtccccatttccagtgtcagcatc
tctgcgagcggcatggtgatcagacccaccttcacttataaccctgcatcacaggtgtta
agcattgatatgaccagcatagacatcagcctccataagttcgtttcactgacgtggaga
agcactctgaatttttag

DBGET integrated database retrieval system