KEGG   Panthera tigris altaica (Amur tiger): 102963756
Entry
102963756         CDS       T02988                                 

Gene name
IFNG
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03050  Proteasome
ptg04060  Cytokine-cytokine receptor interaction
ptg04066  HIF-1 signaling pathway
ptg04217  Necroptosis
ptg04350  TGF-beta signaling pathway
ptg04380  Osteoclast differentiation
ptg04612  Antigen processing and presentation
ptg04630  JAK-STAT signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04940  Type I diabetes mellitus
ptg05140  Leishmaniasis
ptg05142  Chagas disease
ptg05143  African trypanosomiasis
ptg05144  Malaria
ptg05145  Toxoplasmosis
ptg05146  Amoebiasis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05200  Pathways in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ptg05321  Inflammatory bowel disease
ptg05322  Systemic lupus erythematosus
ptg05323  Rheumatoid arthritis
ptg05330  Allograft rejection
ptg05332  Graft-versus-host disease
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    102963756 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102963756 (IFNG)
   04630 JAK-STAT signaling pathway
    102963756 (IFNG)
   04066 HIF-1 signaling pathway
    102963756 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102963756 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102963756 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    102963756 (IFNG)
   04612 Antigen processing and presentation
    102963756 (IFNG)
   04660 T cell receptor signaling pathway
    102963756 (IFNG)
   04658 Th1 and Th2 cell differentiation
    102963756 (IFNG)
   04659 Th17 cell differentiation
    102963756 (IFNG)
   04657 IL-17 signaling pathway
    102963756 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102963756 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102963756 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102963756 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    102963756 (IFNG)
   05323 Rheumatoid arthritis
    102963756 (IFNG)
   05321 Inflammatory bowel disease
    102963756 (IFNG)
   05330 Allograft rejection
    102963756 (IFNG)
   05332 Graft-versus-host disease
    102963756 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102963756 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    102963756 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102963756 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102963756 (IFNG)
   05164 Influenza A
    102963756 (IFNG)
   05168 Herpes simplex virus 1 infection
    102963756 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102963756 (IFNG)
   05144 Malaria
    102963756 (IFNG)
   05145 Toxoplasmosis
    102963756 (IFNG)
   05140 Leishmaniasis
    102963756 (IFNG)
   05142 Chagas disease
    102963756 (IFNG)
   05143 African trypanosomiasis
    102963756 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ptg03051]
    102963756 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102963756 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102963756 (IFNG)
Proteasome [BR:ptg03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    102963756 (IFNG)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interferons
   102963756 (IFNG)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102963756 (IFNG)
SSDB
Motif
Pfam: IFN-gamma
Other DBs
NCBI-GeneID: 102963756
NCBI-ProteinID: XP_007082284
UniProt: A0A5B9GFL5
LinkDB
Position
Un
AA seq 167 aa
MNYTSFIFAFQLCIILCSSGCYCQAMFFKEIEELKGYFNASNPDVADGGSLFVDILKNWK
EESDKTIIQSQIVSFYLKMFENLKDDDQRIQRNMDTIKEDMLDKLLNTSSSKRDDFLKLI
QIPVNDLQVQRKAINELFKVMNDLSPRSNLRKRKRSQNLFRGRRASK
NT seq 504 nt   +upstreamnt  +downstreamnt
atgaattacacaagttttattttcgcttttcagctttgcataattttgtgttcttctggt
tgttactgtcaggccatgttttttaaagaaatagaagagctaaagggatattttaatgca
agtaatccagatgtagcagatggtgggtcgcttttcgtagacattttgaagaactggaaa
gaggagagtgataaaacaataattcaaagccaaattgtctccttctacttgaaaatgttt
gaaaacctgaaagatgatgaccagcgcattcaaaggaacatggacaccatcaaggaagac
atgcttgataagttgttaaataccagctccagtaaacgggatgacttcctcaagctgatt
caaatccctgtgaatgatctgcaggtccagcgcaaagcaataaatgaactcttcaaagtg
atgaatgatctgtcaccaagatctaacctgaggaagcggaaaaggagtcagaatctgttt
cgaggccgtagagcatcgaaataa

DBGET integrated database retrieval system