KEGG   Panthera tigris altaica (Amur tiger): 102963785Help
Entry
102963785         CDS       T02988                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00052  Galactose metabolism
ptg00500  Starch and sucrose metabolism
ptg01100  Metabolic pathways
ptg04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102963785 (MGAM2)
   00500 Starch and sucrose metabolism
    102963785 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102963785 (MGAM2)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102963785 (MGAM2)
    3.2.1.20  alpha-glucosidase
     102963785 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102963785
NCBI-ProteinID: XP_015396891
LinkDB All DBs
Position
Un
AA seq 2383 aa AA seqDB search
MARNLSVLEVLLIIFFLTILALDIFLMLLVLGNPSGHSFVPECPEIPESERIDCVPGHVV
TENVCRWVYKCCWKPVTHTGAPKCFFPRNWGYKVDKRQNDTTGFTAKLKRLPSPSQFGYD
VPDALFAADYQTSNRFHFKITDMDSKRYEVTLENIDLLDRTPKTSNLNYHVEVINEPFSF
KIIRTSNKRILLDTSIGPLQFAHQYLQLSFRLPSTSVYGLGEHVHQQYHHDLTWKTWPIF
TRDAAPTKGMINLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVILQPAPAITYRMIGGIL
DFYVFLGNTPEQVVQEYLELIGRPFLPPYWSLGFQLSRRNYGGINGLRKVVDRNRGAGIP
YDVQYSDIDYMEGGKDFTIDKEAFPRLEDFAKDLHGQGMKYIIIMHPGILNDSNYQPYET
GSKKRVWIWQDNEFAIGQGYPGLTVFPDFSNPVCIEWWREQISEFHKTLEFDGVWIEMDE
VSSFHHGSNRGCESNHLNVPPFTPRVLDGFLSARTLCMDAEFHQGLHYDVHSLYGYSMAK
ATHLAMEGIPLNKSSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGIP
MVGANICGYTKNVTEELCRRWMQLGAFYPLSRNHNGPEFVDQDPVAFGSHSLLVNSSKHY
LNIRYTLLPYLYTLFYRAHTRGDTVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLYE
GVDKVKAYIPDAVWYDYETGVAIQWRKQLVEMQLPPDRIGLHLRGGFIFPTQQPNTTTEA
SRKNPLGLIVALDYKREAKGELYWDNGEFKDEKYILYDFSVASNHLQAKVINNNYTDPNN
LTFTDIIILGMDKQPMNFTVSLKNSYRSILNVTYNVSSKVVRITDLKGLVLGQEFSIKWE
LPVSDLEKFNCYPDEPPLTLEHCRKRGCLWEDTTVPGVPTCYYDTIPSYAASNIQYLPTG
ITTDLTYLMTPESTRAATAAGSLSATISFLRLSVIYHTENMLQFKIFDATNKRYEVPVPL
NIPPSPVGSPENRLYDVRIQNNPFGIQIRRKSSNTVIWDSQLPGFTFNNTFLSISTRLPS
QYLYGFGETEHTAFRRNMSWNMWGMFARDEPPAYKKNSYGVHPYYMALEQDGSAHGVLLL
NSNAMDVSFQPTPALTYRTTGGILDFYMVLGPTPELVTQQYTELIGRPAMTPYWALGFQL
SRYGYENDKEISQLYEAMMAAQIPYDVQHVDIDYMDRKLDFTLSPSFQNLGLLIDQMKKN
GMRFVLILDPAISGNETHYPTFKRGQENNVFIKWPDNNEIVWGKVWPDLPNVNVDATLDH
ETQVKLYRAYVAFPDFLRDSTAAWWKKEIQELYVNPQEPKKSLKFDGLWIDMNEPSNFVD
GSVRGCSDKSLNKPPYMPHLESRDMGLSSKTLCMESQQILPDGSRVRHYDVHSLYGWAQT
RPTYEAVQAVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLRKSIIGMMEFSLFGIS
YTGADICGFFGNAEYEMCLRWMQLGAFYPFSRNHNTIGTRRQDPVAWNSTFEMYSRKVLQ
TRYALLPYLYTLMHKAHVEGSTVVRPLLHEFTNDRVTWDIDRQFMLGPAILISPVLESNT
FEIQAYFPRARWYDYSTESGNTSTGYWKTLEAPLDHINLHIRGGYILPWQEPAMNTQASR
QKFMGLIVALDDNGKAEGQIFWDDGQSIDTYENGNYFLANFIAAQNILQIQTVHNKYLSD
SNPLKVGYIKIWGLNSTYVTQVTFTYDNKQFMEKNFKSDPYNQILTIQLTDKIINLEKLT
EVTWIYGGPIISTTPMTSTFPTESLHPSTVTTKATTFETVITSSASSTTTLPITTTPFPT
STMEDTTNTTITNSTTPSSTSTPTASTSTLPITTTPFSTSTIEMTTSTTSSDPTTPSCTS
TSAASPSTLPITTTPFPTSTIEVTTSTAGPDTPTPAATSATSSISALITTTPFATSTIEV
TTSTAGADTTTPAATSTTTSSSPSTLPVTTTPFPTSTIEMTTSTAGPDTTTPAPTSTTSS
ISTLITTTPFPTSTIEGTTSTAGPDPTTPAPTSTISNTTLPITTTPFATSTIEGTTSTAG
PDPTTPAPTSTISNTTLPITTTPFATSTIEGTTSTAGPDPTTPAPTSTISNTTLPITTTP
FATSTIEGTTSTAGPDPTTPAPTSTISNTTLPITTTPFATSTIEGTTSTAGPDPTTPAPT
STISNTTLPITTTPFATSTIEGTTSTAGPDPTTPAPTNIYSPSTSVIANTTTNTVNGTGH
AVNITDADNSNSVPYNTTHVSIPNATMASDTLMTVLLDTAAHNQVTANSAVSYLPIVATN
ATTDSTNITIYALNTTILDRTTMDASTPVSTYIANTVNATLVP
NT seq 7152 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggaatctgagtgtgttggaagtccttctgatcatcttcttcctaactatactc
gccttagatatcttcttgatgcttttggtgttgggaaatccttcaggtcattcatttgtt
ccagagtgcccagagatccccgaatcagagaggatagactgtgttcctgggcatgtggtg
acagagaatgtctgcagatgggtatataaatgctgctggaagcctgtgacacatacaggt
gccccaaagtgcttcttccctaggaactggggctataaagtcgacaagagacagaatgat
acaacagggtttaccgccaagttgaaaaggctaccatccccatctcagtttggatatgat
gtccctgacgccctcttcgcggctgactatcagacatccaatcgttttcattttaagatc
actgatatggatagcaaacgctatgaagtcacccttgaaaatattgacttgcttgatagg
actcctaagacctctaatttgaactatcacgtagaggtcattaatgagcccttcagcttc
aagatcatacggaccagcaacaaaagaatcttgttggacacgagcatcgggcccctgcag
ttcgcccatcagtacctgcagctgtctttccgactgcccagcacctccgtgtatgggctg
ggagaacacgtgcatcagcagtaccaccacgacctgacctggaagacctggcccatcttc
actcgggatgccgcccccaccaagggcatgattaatctgtatggagctcatacattcttc
ctgtgcctcgaagacaccagcggctcctcttttggggtttttctgttgaacagtaatgcc
atggaggtcatccttcagcctgctcctgcaatcacttaccgcatgattgggggcatcctt
gacttttatgtattcctgggaaatactccagaacaagtggttcaggaatatctggagctc
attggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcaggaac
tatggcggcatcaatggattgaggaaggttgtggaccgaaatcgtggagctgggatccca
tatgacgtccagtactctgacatagactacatggaagggggaaaggatttcacgattgat
aaagaggctttccctcgtctcgaagattttgccaaagacttgcatggccaaggaatgaaa
tatataatcattatgcatcctggaatattaaatgactctaactaccagccctatgagact
ggaagtaagaagagagtatggatctggcaggacaatgaatttgccattggacagggatat
cccggattgacggtctttcctgattttagcaatccagtttgtattgagtggtggagagag
cagatcagtgaatttcataaaactctcgagtttgatggagtgtggattgaaatggatgaa
gtatccagctttcaccacgggtccaatcgtgggtgtgagtcaaaccacttgaatgttcct
cctttcactcccagagttctggacggcttcctttctgcaagaaccctctgcatggatgca
gaatttcatcagggccttcactatgatgtccacagcttgtatggctactccatggcaaaa
gctacacacttggccatggagggtattcccttgaacaaaagtagcttcatcttatcccgt
tctacttttgctgggtctggcaagtttgctgctcattggttgggagacaatgcagccaca
tgggatgatctccgatggtccatccctagtatccttgagttcaacctatttggtatcccc
atggtaggtgccaacatctgtggttatacaaaaaatgtcacagaggagctctgcagaagg
tggatgcagcttggagccttttatccactatcaaggaatcataatgggcctgagttcgtg
gatcaggatcccgttgcctttggcagccactctctgctggtgaattcctccaaacattat
ctgaacatccgctacactctactcccctatctctacacccttttctaccgagctcacacc
cggggagacaccgtggcaaggccccttgtccatgagttctaccaggacccagctacatgg
gaggtgcacgagcagttcttatgggggcctggacttctcatcacacctgttttatacgag
ggtgtggacaaagtgaaggcatacataccggatgccgtgtggtacgactatgagacagga
gtagctatccagtggaggaaacaactggtagagatgcagctaccacccgataggattgga
cttcacctccgtgggggcttcatatttcccacccagcagcccaacacaaccactgaggcc
agtcggaagaatcccctgggactcattgttgccttggactataagagagaagcgaaggga
gagctgtactgggataatggtgaattcaaagatgaaaagtatattctgtatgatttttct
gtcgcctctaaccatctacaggcaaaggttataaataataactatacggaccccaacaac
ctcacgtttacagatatcataatcttgggaatggacaagcaacctatgaatttcactgtt
tcattgaagaattcttacaggtccattttaaatgttacctacaatgtttcatcaaaggtg
gtgaggattactgatctcaagggactggtacttggacaagaattctccattaaatgggaa
cttccagtcagtgacctggagaaattcaactgctaccctgatgagccccccctcactctg
gagcattgcaggaagcggggctgcctctgggaggacacaactgttcctggtgtgcctacc
tgttactatgacaccatccctagttatgctgccagtaacattcagtacctgcccacgggc
atcaccacagacctcacctacctgatgacccctgaatcaactcgagcagccactgctgct
ggttctctttctgcaacgatcagcttcctccgcctgagtgtcatctaccatacagaaaac
atgctgcagttcaagatctttgatgccactaacaaaaggtacgaggtcccagtgcctctg
aacatacctccctctcctgttggctcccctgaaaaccgtctgtatgatgtcaggattcag
aacaatccttttgggatccagattcgacgaaaaagctccaacactgtgatttgggactct
cagctccccggctttactttcaacaacacgttcctctccatttcgactcgcctcccctct
cagtacctctacggctttggggagactgagcacacagctttcaggagaaatatgagctgg
aacatgtggggaatgttcgctcgtgatgagccacccgcgtacaagaagaattcctatggc
gtccacccctactacatggcactggagcaggatggcagtgcccatggggtgctcctgcta
aacagcaacgccatggatgtatcattccagcccactcctgccctgacataccgcaccaca
ggagggattttggacttttatatggttttggggccaacccccgagcttgtaactcaacag
tacactgagttgattggtcggccagcaatgactccatactgggccttgggattccagcta
agtcgctatggatacgagaatgataaggagatctcccaattgtatgaggcaatgatggcg
gcccagattccctatgatgtccagcatgtagacatcgattacatggaccggaagctggac
ttcactctcagccccagcttccaaaacctcggtctcttgattgaccaaatgaagaaaaat
ggcatgagattcgttctcattctggacccagccatttctggcaacgagacccattatccc
acattcaagagagggcaggaaaacaacgtattcatcaaatggcctgataacaatgaaatc
gtctggggaaaggtttggccagacttgcccaatgtgaatgtggatgccacccttgaccat
gaaactcaggttaagctgtacagagcctacgttgcttttcctgacttcttacgtgatagc
acagctgcatggtggaagaaggaaatacaggagctctatgtgaaccctcaagagccaaag
aagagcttgaagtttgatggattgtggattgacatgaatgagccatcaaactttgtggat
ggatctgtcaggggctgcagtgataaaagtcttaacaagccaccctatatgccacatttg
gagtccagggacatgggccttagcagcaagaccctgtgcatggagagtcagcagatcctg
ccagatggctcacgggtgcgacactatgacgtgcacagcctgtacggatgggcccagacc
agacccacctacgaagccgtgcaggcggtgacaggacagcgaggggtcgtcatcacccgc
tccacgttcccttcttctggccgctggggaggtcactggctgggagacaacacggccgcg
tgggaccagctgaggaagtctatcattggcatgatggagttcagtctctttggaatatct
tatacaggagcagatatttgtgggttctttggaaatgccgaatatgagatgtgtcttcgc
tggatgcagctgggggccttttacccattttccagaaaccacaacaccatcgggacaagg
agacaagatcctgtggcctggaattcaaccttcgagatgtactcaagaaaagtccttcag
accagatacgccctgctgccttacctctacactttgatgcataaagctcacgttgagggc
agcactgtcgtccgaccccttctccatgagtttacaaatgacagagtgacatgggatata
gaccgtcagtttatgttgggccctgctatcttaatcagccccgtgctggaaagtaacact
tttgagatccaagcttattttcccagagcccgttggtacgactacagcacggaatctggc
aatacgtcaacaggttactggaaaaccctggaggctccccttgaccacatcaaccttcat
atcagaggaggctacatcctgccttggcaagagcctgcaatgaacactcaggccagtcga
caaaaatttatgggattgattgttgctttggatgacaatgggaaagctgaaggtcagata
ttctgggacgatggacaaagcattgatacctatgaaaatggaaactatttcttggcaaac
tttatagcagctcagaacatattgcaaatccagaccgtgcacaataagtatttgagtgac
tcaaatccactgaaagttggatatattaaaatctgggggctaaactctacttatgtgaca
caagtcacttttacttatgacaacaagcaattcatggagaagaatttcaagagtgaccct
tacaatcagatactaacaattcaattgactgacaagattatcaacctggaaaaactaact
gaggttacctggatatacggtggccctataatttccactacacctatgacaagtaccttc
ccgacagagtctctacatccttctacagttacgactaaggctaccacttttgaaactgtt
atcactagttctgcgagtagtactacgactcttcctatcacaaccactcctttcccaaca
agtactatggaagatacaacaaatactactattactaatagcactacaccatcctctaca
agtacccctactgctagcactagtactcttcctatcacaaccactcctttctcaacaagt
actattgaaatgacaactagtactaccagttctgatcccactacaccatcctgtacaagt
acctctgctgctagtcctagtactctgccgatcacaaccactcctttcccaacaagtact
attgaagtgacaacaagtactgctggtcctgatacccctacacctgctgctacaagtgct
actagtagtattagtgctcttatcacaaccactcctttcgcaacaagtactattgaagtg
acaactagtactgctggtgctgataccactacacctgctgctacaagtactactactagt
agtagtcctagtactctgcctgtcacaaccactcctttcccaacaagtactattgaaatg
acaactagtactgctggtcctgataccaccacacctgcccctacaagtactactagtagt
attagtactcttatcacaaccactcctttcccaacaagtactattgaagggacaactagt
actgctggtcctgatcccaccacccctgcccctacaagtactatttctaatactacgctt
cctattacaaccactcctttcgcaacaagtactattgaagggacaactagtactgctggt
cctgatcccaccacccctgcccctacaagtactatttctaatactacgcttcctattaca
accactcctttcgcaacaagtactattgaagggacaactagtactgctggtcctgatccc
accacccctgcccctacaagtactatttctaatactacgcttcctattacaaccactcct
ttcgcaacaagtactattgaagggacaactagtactgctggtcctgatcccaccacccct
gcccctacaagtactatttctaatactacgcttcctattacaaccactcctttcgcaaca
agtactattgaagggacaactagtactgctggtcctgatcccaccacccctgcccctaca
agtactatttctaatactacgcttcctattacaaccactcctttcgcaacaagtactatt
gaagggacaactagtactgctggtcctgatcccaccacccctgcccctacaaatatttat
tctcctagcactagtgtaatagctaataccaccaccaacactgtaaacggtacagggcat
gcagtaaatattactgatgcagacaactctaacagtgttccatataacactacccatgtt
tctattccaaatgctacaatggcctcagacacattaatgactgttcttctagacacagca
gctcacaatcaggtaacagccaactctgcagttagttatttacctattgttgcaactaat
gctaccacagatagtacaaatattaccatatatgctttaaacactaccattcttgataga
acaacaatggatgcttctactcctgtatctacctacattgcaaacaccgtaaatgctact
ctagttccatga

DBGET integrated database retrieval system