KEGG   Panthera tigris altaica (Amur tiger): 102964051
Entry
102964051         CDS       T02988                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04012  ErbB signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04115  p53 signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04218  Cellular senescence
ptg04630  JAK-STAT signaling pathway
ptg04921  Oxytocin signaling pathway
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04934  Cushing syndrome
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05211  Renal cell carcinoma
ptg05212  Pancreatic cancer
ptg05213  Endometrial cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05216  Thyroid cancer
ptg05217  Basal cell carcinoma
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05223  Non-small cell lung cancer
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102964051 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102964051 (CDKN1A)
   04066 HIF-1 signaling pathway
    102964051 (CDKN1A)
   04068 FoxO signaling pathway
    102964051 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102964051 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102964051 (CDKN1A)
   04115 p53 signaling pathway
    102964051 (CDKN1A)
   04218 Cellular senescence
    102964051 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102964051 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102964051 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102964051 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102964051 (CDKN1A)
   05206 MicroRNAs in cancer
    102964051 (CDKN1A)
   05205 Proteoglycans in cancer
    102964051 (CDKN1A)
   05203 Viral carcinogenesis
    102964051 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102964051 (CDKN1A)
   05212 Pancreatic cancer
    102964051 (CDKN1A)
   05225 Hepatocellular carcinoma
    102964051 (CDKN1A)
   05226 Gastric cancer
    102964051 (CDKN1A)
   05214 Glioma
    102964051 (CDKN1A)
   05216 Thyroid cancer
    102964051 (CDKN1A)
   05220 Chronic myeloid leukemia
    102964051 (CDKN1A)
   05217 Basal cell carcinoma
    102964051 (CDKN1A)
   05218 Melanoma
    102964051 (CDKN1A)
   05211 Renal cell carcinoma
    102964051 (CDKN1A)
   05219 Bladder cancer
    102964051 (CDKN1A)
   05215 Prostate cancer
    102964051 (CDKN1A)
   05213 Endometrial cancer
    102964051 (CDKN1A)
   05224 Breast cancer
    102964051 (CDKN1A)
   05222 Small cell lung cancer
    102964051 (CDKN1A)
   05223 Non-small cell lung cancer
    102964051 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102964051 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102964051 (CDKN1A)
   05161 Hepatitis B
    102964051 (CDKN1A)
   05160 Hepatitis C
    102964051 (CDKN1A)
   05163 Human cytomegalovirus infection
    102964051 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102964051 (CDKN1A)
   05169 Epstein-Barr virus infection
    102964051 (CDKN1A)
   05165 Human papillomavirus infection
    102964051 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102964051 (CDKN1A)
   01522 Endocrine resistance
    102964051 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102964051
NCBI-ProteinID: XP_007085316
LinkDB
Position
Un
AA seq 164 aa
MSEPSRDAHQIPHGSKACRRLFGPVDSEQLRRDCDALMAGCVQEARERWNFDFVTETPLE
GDFAWERVWGLGLPKLYLPAGPRGGRDDLGGGKRPSTSSTLLPGTAREDHLDLSLSCTLM
PHSPERPEASPGAPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccgtccagggatgcccaccagatcccacatggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgcgccgagactgtgacgcgttaatggcaggc
tgcgtgcaggaggcccgggagcgatggaacttcgactttgtcaccgagacaccgctggag
ggcgactttgcctgggagcgtgtgtggggcctgggcctgcccaagctctacctgcctgca
gggccccgggggggccgggatgacctgggagggggcaagcggcccagcacctcgtctacc
ctgctgccggggacagctcgggaggaccacctggacctgtccctgtcctgcactctcatg
cctcactcccctgagcggcctgaggcgtctccgggtgcacctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system