KEGG   Panthera tigris altaica (Amur tiger): 102964358
Entry
102964358         CDS       T02988                                 

Gene name
IL5
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04630  JAK-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04657  IL-17 signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05200  Pathways in cancer
ptg05310  Asthma
ptg05320  Autoimmune thyroid disease
ptg05321  Inflammatory bowel disease
ptg05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102964358 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102964358 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102964358 (IL5)
   04660 T cell receptor signaling pathway
    102964358 (IL5)
   04658 Th1 and Th2 cell differentiation
    102964358 (IL5)
   04657 IL-17 signaling pathway
    102964358 (IL5)
   04664 Fc epsilon RI signaling pathway
    102964358 (IL5)
   04672 Intestinal immune network for IgA production
    102964358 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102964358 (IL5)
  09163 Immune disease
   05310 Asthma
    102964358 (IL5)
   05320 Autoimmune thyroid disease
    102964358 (IL5)
   05321 Inflammatory bowel disease
    102964358 (IL5)
   05330 Allograft rejection
    102964358 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102964358 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102964358 (IL5)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Interleukins
   102964358 (IL5)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102964358 (IL5)
SSDB
Motif
Pfam: IL5
Other DBs
NCBI-GeneID: 102964358
NCBI-ProteinID: XP_007087833
LinkDB
Position
Un
AA seq 134 aa
MRMLLHLSLLALGAAYVSAIAVQSPMNRLVAETLALLSTHRTLLIGDGNLMIPTPEHNNH
QLCIEEVFQGIDTLKNRTAPGDAVDKLFRNLSLIKEHIDLQKKKCGGERWRVKKFLDYLQ
VFLGVINTEWTMES
NT seq 405 nt   +upstreamnt  +downstreamnt
atgagaatgcttctgcatttgagtttgctagctcttggggctgcctatgtttctgccatt
gctgtacaaagtcccatgaataggctggtggcagagaccttggcactgctctccactcat
cgaactctactgataggcgacgggaacctgatgattcctactcctgaacataacaatcac
caactgtgcattgaagaagtctttcagggtatagacacattaaagaatcgcactgcaccg
ggggatgctgtggacaagcttttccgaaacttgtctttaataaaagaacacatagacctc
caaaaaaaaaagtgtggaggagaaagatggagagtaaaaaagttcctagactacctgcaa
gtgtttcttggtgtaataaacactgagtggacaatggaaagttga

DBGET integrated database retrieval system