KEGG   Panthera tigris altaica (Amur tiger): 102964388Help
Entry
102964388         CDS       T02988                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04064  NF-kappa B signaling pathway
ptg04210  Apoptosis
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04668  TNF signaling pathway
ptg04672  Intestinal immune network for IgA production
ptg05166  Human T-cell leukemia virus 1 infection
ptg05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102964388 (MAP3K14)
   04064 NF-kappa B signaling pathway
    102964388 (MAP3K14)
   04668 TNF signaling pathway
    102964388 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102964388 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102964388 (MAP3K14)
   04660 T cell receptor signaling pathway
    102964388 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102964388 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    102964388 (MAP3K14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    102964388 (MAP3K14)
   05169 Epstein-Barr virus infection
    102964388 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102964388 (MAP3K14)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102964388 (MAP3K14)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: STE group
  Other
   102964388 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 102964388
NCBI-ProteinID: XP_015398223
LinkDB All DBs
Position
Un
AA seq 869 aa AA seqDB search
MAVMEMACPGAPGSAAGQKELAKAKEKTQAMGKKQNPANKLEAVEKSPVFCGKWDILNDV
ITKGTAKEGSEGGLAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNNV
AHATEGKMARVCWKGKRRSKAQKKRKKKSSKSLAQAGAALAKPLPRTPEQESCTVPVQVS
PASAPQTPGSPWKPRPLESFFLDKLACIDSQQPLSGPHLGKLACVDGQKPVPGPHLEPGC
PSRGPYDKFSVEEYMVHALQGSVSSGQAHSLASLAKTWSAGGFKPQKPSPETMDSEGVLL
TEKLKPVDYEYREEVHWATRQPCLGRGSFGEVHRMQDKQTGFQCAVKKVRIEVFRAEELM
ACAGLTSPRIVPLYGAVKEGPWVNIFMELLEGGSLGQLIKQKGCLPEDRALYYLGQALEG
LEYLHTRRILHGDIKADNVLLSSDGSRAALCDFGHAVCLQPDGLGKSLLTGDYIPGTETH
MAPEVVMGKPCDAKVDVWSSCCMMLHMLNGCHPWTQYFRGPLCLKIASEPPPVREIPPSC
APLTAQAIQEGLRKEPGHRASAVELWRKVSLALQHVGGLRSPWRGEYKEPRHPPPHQAHX
AAQPRPLSPDGTXXXXPGSPGPQPPEDTTGGAPGLQPPLPPEPPERNKSPSLNWGKEESG
TWEPLPLSSLDPTPAKNPSSAERKATFPEQELQQLEIELFLNSLSQPFSLEEQEQILSCL
SVDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARSSSWNMVLARGRPTDTPSYF
NGVKIQIQSLNGEHLHIREFHRVKVGDIATGISSQIPAAAFSLVTKDGRPVRYDMEVPDS
GIDLQCTLAPDGSFAWSWRVKHGHLENRP
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggcgcccctggttcggcggccgggcagaaggag
ctcgccaaggccaaggagaagacacaggcgatggggaagaagcaaaaccccgccaacaag
ctcgaggccgtagagaagagccctgtgttctgcgggaagtgggacatcctgaacgacgtg
atcaccaaaggcacagccaaggaaggctccgagggaggactggccgccatctccatcatc
gcgcaggccgaatgtgagaacagccaagagttcagccctaccttttcagagcggattttc
atcgccgggtccaaacagtacagccagtccgagagtctcgatcagatccccaacaatgtg
gcccacgcaaccgagggcaaaatggcccgtgtgtgttggaaggggaagcgtcgcagcaaa
gcccagaagaaacgcaagaagaagagctccaagtccctggctcaggcgggagcggccttg
gccaaacccctccccagaaccccggagcaggagagctgcactgtccccgtgcaggtgagc
cccgccagcgccccccagaccccgggctcgccctggaaacctcgccccttagagtccttc
tttctagacaaactggcctgtatagacagccagcagcccctgtccggcccccacctgggc
aaactggcctgtgtggacggtcagaagcctgtgcccggcccacacttggagcccggctgc
ccgtcccggggcccgtatgacaagttttctgtggaggagtacatggtacacgccctacaa
ggcagtgtgagctcaggccaggcccacagcctggccagcctggccaagacctggtcggca
ggaggtttcaagccccagaagcccagccctgaaacgatggacagcgagggggtcctgctt
acagagaaactcaagccggtggattatgagtaccgagaggaggtccactgggccacgcgc
cagccctgcctgggcagaggctccttcggagaggtgcacaggatgcaggacaagcagact
ggcttccagtgtgcggtcaaaaaggtgcgcatcgaagtgtttcgggcagaggagttgatg
gcatgtgcaggactgacctcacccagaatcgtccctctgtatggagctgtgaaggaaggt
ccttgggtcaacatcttcatggaactcttagaaggtggctcgctgggccagctcataaag
cagaagggctgtctgccggaggaccgggccctttactacctaggccaggctctggaaggg
ctggagtaccttcacacccgaaggattctgcacggagatatcaaagctgacaatgtgctc
ctgtccagcgatgggagccgtgcagccctctgtgacttcggccatgctgtgtgccttcaa
cccgatggcctggggaagtccttgctcacgggggactacatccctggcacagagacccac
atggctccagaggtggtgatgggcaagccctgtgatgccaaggtggacgtatggagcagc
tgctgtatgatgcttcacatgctcaacggctgccacccttggacccagtacttcagaggg
ccactgtgcctcaagattgccagcgagccgccacctgtgagggagatcccaccgtcctgt
gcccctctcacggcccaggccatccaggaggggctaaggaaagagcctgggcaccgcgcg
tctgcagtggagctgtggaggaaggtcagcctggccctgcagcatgtgggaggtctgagg
agcccttggaggggagagtataaagagccaagacatccgccgccacaccaagcccatncc
gccgcccagccaaggccactctccccggacggcacnnnnnnnnnnncgcctgggtctccg
ggcccccagccacccgaggacacgacaggcggggcccctgggctccagcctcctctaccc
ccagaacccccagagcggaacaagtctccaagcctgaactggggcaaggaggagtctgga
acatgggaaccattacctctgtcctccctggacccgactcctgcgaaaaaccccagctcg
gcggagcggaaggcgaccttcccagagcaggagctgcaacaactggaaatagaactattt
ctgaacagcctgtcccagccgttttcactggaggagcaggagcagattctctcgtgcctc
agcgtcgacagcctctctctgtcagacgacagcgagaagaacccgtcaaaggcctctcag
agctcgcgggacaccctgagttccggtgtgcactcgtggagcagccaggcagaggctcgc
agctccagctggaacatggtgctggcacgggggcggcccaccgacactccaagctacttc
aatggtgtgaaaatccaaatacagtctctcaacggcgaacacctgcacatccgggagttt
caccgggtcaaggtgggggacatcgcaactggcatcagcagccagatcccagccgcagcc
ttcagcttggtgaccaaggacgggcggcccgtgcgctatgacatggaggtgccagactcg
ggcatcgacctgcagtgcaccctggcccctgatggcagctttgcctggagctggagggtc
aagcatggccacctggagaacaggccctaa

DBGET integrated database retrieval system