KEGG   Panthera tigris altaica (Amur tiger): 102964404Help
Entry
102964404         CDS       T02988                                 

Gene name
DPM1
Definition
(RefSeq) dolichyl-phosphate mannosyltransferase subunit 1, catalytic
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00510  N-Glycan biosynthesis
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102964404 (DPM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102964404 (DPM1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     102964404 (DPM1)
Glycosyltransferases [BR:ptg01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   102964404 (DPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_transf_21 Glyco_tranf_2_4
Motif
Other DBs
NCBI-GeneID: 102964404
NCBI-ProteinID: XP_007078064
LinkDB All DBs
Position
Un
AA seq 260 aa AA seqDB search
MASEEASGSPRRSRREPEGRVPRQDKYSVLLPTYNERENLPLIVWLLVKSFSESGISYEI
IIIDDGSPDGTRDVAEQLEKIYGSDKILLRPREKKLGLGTAYIHGMKHATGNYIIIMDAD
LSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVYGWDLKRKIISRGANFITQILLRPGA
SDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQLNYTIGEVPISFVDRVYGESK
LGGNEIVSFLKGLLTLFATT
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgaggaagcgagcggcagccctcgtaggtctcggcgggagccggaggggcgc
gtcccgcgacaggacaagtattcggtgcttttgcccacttacaacgagcgcgagaaccta
ccgctcatcgtgtggctgctggtgaaaagcttctccgagagtggaatcagctatgaaatt
ataatcatagatgatggaagcccagatggaacaagggatgttgctgaacagttggagaag
atctatgggtcagacaaaattcttctaagaccacgtgagaagaagttaggactgggaact
gcatatattcatggaatgaaacatgccacaggaaactacataataattatggatgctgat
ctctcacaccatccaaaatttattcctgaattcattaggaagcagaaggagggtaatttt
gacattgtctctggaactcgctacaaaggaaatggaggtgtatatggctgggatttgaaa
agaaaaataatcagccgtggggccaattttataactcagattttgctcagaccaggagca
tctgatttaacaggaagtttcaggttataccgaaaagaagtcctacagaaattaatagaa
aaatgtgtttccaaaggctatgtcttccagatggagatgattgttcgggcaagacagttg
aattatactattggcgaggttccaatatcattcgtggatcgcgtttacggtgaatccaag
ttgggaggaaatgaaatagtctctttcttgaaaggattattgactctttttgctactaca
taa

DBGET integrated database retrieval system