KEGG   Panthera tigris altaica (Amur tiger): 102964430Help
Entry
102964430         CDS       T02988                                 

Gene name
DCLRE1C
Definition
(RefSeq) protein artemis
  KO
K10887  DNA cross-link repair 1C protein [EC:3.1.-.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg03450  Non-homologous end-joining
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    102964430 (DCLRE1C)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102964430 (DCLRE1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102964430 (DCLRE1C)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     102964430 (DCLRE1C)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Other NHEJ factors
     102964430 (DCLRE1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DRMBL
Motif
Other DBs
NCBI-GeneID: 102964430
NCBI-ProteinID: XP_007081313
LinkDB All DBs
Position
Un
AA seq 575 aa AA seqDB search
MKHQVRFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPKFYQ
IPSREECLSGILELVRSWITRSPYHVVWLNCKAAYGYEYLFTHLSEEFGIQVHVDKLDMF
RNMPDILHHLTTDRNTQIHACRHPKAEEYFHWNKLPCGNISKNRIPLHTISIKPSTMWFG
ERTRKTNVIVRTGESSYRACFSFHSSYSEVKDFLSYICPVNVYPNVIPIGTTMDKVVEIL
KPLCRSSQSTEPKYKPLGKLKRARKTHLDSEEEDDLFDDPVPLPLRHKVPYQLTLHPDVY
LMTAASPSQPEQERQSTGYKESMHTFPLANFIECEESNSEGEEELQTPASSQEDLGAVTH
HQQKADVEVPQWEVFFKRNDEITDDSLENLPSSTEAGGSQSPKIFSDSDGESTHISSQNS
SQSTHISEQGSQGWDSQSDTVLLSSQERNSGDITFLNKGSYRPRIKENIPASQMEQNVLC
PKDTYSDLKSRNQDANMAPGVGEITTLSSGKHIPQEKRLLNFSTNADSQSSSDFEIPSTP
EAELPKGEHLQYLYEKLATGENIVTEKRKSSFSDT
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaagcatcaggtgaggtttttatttcagggcaataatggaacggttttgtacacggga
gacttccgattggcacagggggaagctgccagaatggagctcctgcattctgggggcaga
gtgaaagacatccaaagtgtatacctagatactactttctgtgatccgaaattttaccag
attcctagtcgagaggagtgtctgagcggaatattagagctggttcgcagctggatcact
cggagtccgtaccatgtcgtgtggctgaactgcaaagcagcttacgggtatgagtatctg
ttcacccacctgagcgaggaatttggaatccaggttcacgtggacaaattagacatgttt
aggaacatgcccgacattcttcatcacctcacaacagaccggaatactcagatccatgcc
tgtcgccatccgaaggcagaagaatattttcattggaataaattaccctgtggaaatatt
tccaaaaatagaattccactccacacaatcagcattaagccatccactatgtggtttgga
gaaaggaccagaaaaacaaatgtaattgtgaggactggagagagttcatacagagcttgt
ttttcttttcactcttcctacagtgaggttaaagatttcttgagctacatctgtcctgtg
aatgtgtatcccaatgtcattccaataggcacaactatggataaagttgtagaaatctta
aagcctttatgccgatcttcccaaagtactgagcccaagtataaaccacttggaaaattg
aagagagctagaaaaactcacctagactcagaggaggaagatgacctctttgatgatcct
gtgccgttaccgctaaggcacaaggttccataccagctaactcttcaccctgacgtgtat
ctgatgactgcagcttccccaagccagcctgagcaagagagacaaagcacagggtacaaa
gagagtatgcatacctttcctttggcaaactttatagaatgtgaagaatccaacagcgaa
ggtgaagaagaattacaaaccccagcttcatctcaagaagacctgggtgctgtcacacat
caccagcaaaaggctgatgtagaagtaccacagtgggaagtgttctttaaaagaaatgat
gaaatcacagatgacagtttggaaaacctcccttcttccacagaggcagggggctctcag
tcgccaaagatttttagtgactctgatggagagtcaactcacatctcttcccagaattct
tctcagtcaacacacatatccgaacaagggagtcaaggctgggacagccaatcggacact
gttttgttatcatcccaagagagaaacagtggggatattaccttcttgaacaaaggcagc
tatagaccaagaatcaaagagaatattcctgcctctcagatggaacaaaatgtactttgc
ccaaaggatacttattctgacttgaaaagcagaaatcaagatgcaaatatggctcctggt
gttggagaaataaccactctaagcagtgggaaacacatacctcaggaaaaaaggctacta
aattttagcaccaatgcagattcccagagctcctctgattttgaaattccctccacacca
gaagctgagctacctaaaggagagcatttacagtatttatatgagaagctggcaacaggg
gagaatatagtcactgaaaaaagaaaaagctcattctcagatacttaa

DBGET integrated database retrieval system