KEGG   Panthera tigris altaica (Amur tiger): 102964512
Entry
102964512         CDS       T02988                                 

Gene name
GUSB
Definition
(RefSeq) glucuronidase beta
  KO
K01195  beta-glucuronidase [EC:3.2.1.31]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00040  Pentose and glucuronate interconversions
ptg00053  Ascorbate and aldarate metabolism
ptg00531  Glycosaminoglycan degradation
ptg00860  Porphyrin and chlorophyll metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
ptg01240  Biosynthesis of cofactors
ptg04142  Lysosome
Module
ptg_M00014  Glucuronate pathway (uronate pathway)
ptg_M00076  Dermatan sulfate degradation
ptg_M00077  Chondroitin sulfate degradation
ptg_M00078  Heparan sulfate degradation
ptg_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102964512 (GUSB)
   00053 Ascorbate and aldarate metabolism
    102964512 (GUSB)
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    102964512 (GUSB)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    102964512 (GUSB)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102964512 (GUSB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102964512 (GUSB)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.31  beta-glucuronidase
     102964512 (GUSB)
SSDB
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 PAD_porph
Other DBs
NCBI-GeneID: 102964512
NCBI-ProteinID: XP_007079155
LinkDB
Position
Un
AA seq 571 aa
MPVPSSFNDVGQDRQLRSFVGWVWYEREATLPQRWTQDLGTRVVLRIGSAHYYAIVWVNG
VHVAEHEGGHLPFEADISKLVQSGPLASCRITVAINNTLTPHTLPPGTILHQTDTSKYPK
GYFVQNINFDFFNYAGLHRPVLLYTTPATYIDDITVSTSVDQDTGLVDYQIFVEGGEHFQ
LEVRLLDEEGKAVAQGTGGRGQLHVPDAHLWWPYLMHEHPAYLYSLEVRLTAQTAAGSVS
DFYTLPVGIRTVAVTEHQFLINGKPFYFHGVNKHEDADIRGKGFDWPLLVKDFNLLRWLG
ANAFRPYAEEVMQLCDRYGIVVIDESPGVGIVLVESYGNVSLQHHLEVMEELVRRDKNHP
AVVMWSVANEPASFLKPAGYYFKTLIAHTKALDPSRPVTFVTNSNYEADLGAPYVDVICV
NSYYSWYHDYGHMEVIQLQLTTQFENWYRTYQKPIIQSEYGADTIAGFHQDPPLMFSEEY
QKGLLEQYHLVLDQKRKEYVVGELIWNFADFMTNQSPQRVMGNKKGIFTRQRQPKGAAFL
LRERYWKLANETRYPWSAVKSPCLENSPFTL
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgccggttccctccagcttcaatgacgtgggccaggataggcagctgcgcagctttgtc
ggctgggtgtggtacgagcgggaggcgaccctgccccagcgatggactcaggacctgggc
accagagtggtgctgaggattggcagcgcccactactatgccattgtgtgggtgaatggg
gtccacgtggcagagcatgaggggggccatctccccttcgaggctgacatcagcaagctg
gtacagagtgggcccctggcctcttgccgcattaccgttgccatcaacaacacgctcacc
ccccacactctgccgccagggaccatcctccaccagacggatacctccaagtaccccaag
ggttactttgtccagaacataaactttgacttcttcaactacgcggggctgcatcggccc
gtgctcctctacaccacacctgccacctacatcgatgacatcaccgtcagcaccagcgtg
gaccaagacactgggctggtggattaccagatttttgttgaaggcggtgaacactttcaa
ctggaagtgcgtcttctggacgaggaaggcaaagccgtggcccaggggacggggggtcgg
ggccagctgcacgtgcccgatgcccacctctggtggccatacctgatgcatgagcaccct
gcctacctgtactcattggaggtgaggttgaccgcgcagacggcagctgggtctgtgtct
gacttctacactctccccgtggggattcgcacggtggctgtcacagagcaccagttcctc
atcaatgggaaacctttctatttccacggggtcaacaagcacgaggatgcagatatccga
gggaagggctttgactggccactgctggtgaaggacttcaatttgcttcgctggctcggg
gccaacgccttccgcccctacgcggaggaggtgatgcagctctgtgaccgctatgggatc
gtggtcatcgacgagagtcccggtgtgggcatcgtgctggtcgagagctacggcaacgtg
tctctgcagcaccacctggaggtgatggaggagctggtgcgcagggacaagaatcacccg
gctgttgtgatgtggtctgtggccaatgagcccgcttccttcctgaaacctgccggttac
tacttcaagacgctgattgctcacaccaaagccttggatccctcccggcccgtgaccttt
gtgaccaactccaactatgaagcagatctgggggcgccgtatgtggacgtcatctgtgtg
aatagttactactcttggtatcatgactatggtcacatggaggtgattcagctgcagctg
acaacccagtttgagaactggtacaggacctatcagaaaccaataatccagagcgagtac
ggagcagacaccattgcagggtttcaccaggacccacctctgatgttcagcgaggaatac
cagaaaggtctgctggagcagtatcatttggttctggatcaaaaacgcaaagaatacgtg
gtcggagagctcatctggaactttgccgattttatgactaaccagtcaccgcagagagta
atggggaataaaaaggggatcttcacgcgccagagacaaccaaaaggggcagcgttcctt
ttgcgagagagatactggaaacttgccaatgaaaccaggtatccctggtcggctgtgaag
tcaccgtgtttggaaaacagcccatttactctttaa

DBGET integrated database retrieval system