KEGG   Panthera tigris altaica (Amur tiger): 102964536
Entry
102964536         CDS       T02988                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic peptidase activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg04115  p53 signaling pathway
ptg04210  Apoptosis
ptg04215  Apoptosis - multiple species
ptg05010  Alzheimer disease
ptg05012  Parkinson disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05020  Prion disease
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05134  Legionellosis
ptg05152  Tuberculosis
ptg05160  Hepatitis C
ptg05161  Hepatitis B
ptg05162  Measles
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102964536 (APAF1)
   04215 Apoptosis - multiple species
    102964536 (APAF1)
   04115 p53 signaling pathway
    102964536 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102964536 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102964536 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102964536 (APAF1)
   05012 Parkinson disease
    102964536 (APAF1)
   05014 Amyotrophic lateral sclerosis
    102964536 (APAF1)
   05016 Huntington disease
    102964536 (APAF1)
   05020 Prion disease
    102964536 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102964536 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    102964536 (APAF1)
   05152 Tuberculosis
    102964536 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    102964536 (APAF1)
   05160 Hepatitis C
    102964536 (APAF1)
   05164 Influenza A
    102964536 (APAF1)
   05162 Measles
    102964536 (APAF1)
   05168 Herpes simplex virus 1 infection
    102964536 (APAF1)
   05169 Epstein-Barr virus infection
    102964536 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102964536 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Utp8 AAA_16 Hira NACHT AAA_22
Other DBs
NCBI-GeneID: 102964536
NCBI-ProteinID: XP_007085712
LinkDB
Position
Un
AA seq 1250 aa
MDAKARNCLLQHREALEKDIKTSYIMDCMINDGVLTVSEEEKVKNEPTQQQRAALLIKMI
LKKDNDSYISFYNALIHEGYKYLAGLLHAGIPVISSSNGGKDSVGGITSYVRTVLCEGGV
PQRPVVFVTRKKLVNSIQQNLFKLNGEPGWVIIYGMAGCGKSVLAAETVRDHSFLDGCFP
GGVHWVSVGKQDKSGLLMKLQNLCARLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSL
LILDDVWDPWVLKAFDNQCQILITTRDKSVTDSVMGPKYVVSVESGLGKEKGLEILSLFV
NMKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWDYYLRQLQNKQFKRIRKSSFY
DYEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFV
NKSLLFCDRNGKSFCYYLHDLQVDFLIEKNRNQLQDLHKKLVTQFQRHHQPHTLSPDQED
CMYWYNFLAYHMASANMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCA
VCENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWIN
KKNNKNLSRLVVRPHTDAVYHACFSEDGQRIASCGVDKTLQVFKAETGEKLLEIKAHEDE
VLCCAFSADDRFIATCSVDKKVKIWNSMTGELVHIYDEHSEQVNCCHFTNNSHHLLLATA
SSDCFLKLWDLTQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVKSANERE
SINVKQFFLNSEEPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHASGLLAEIHTGH
HSTIQYCDFSPQNHLAVVALSQCCVELWNMDSCLKVADCRGHLSWVHCVMFSPDGSSFLT
SSDDQTIRLWETKKVCENSAIVLKQEIDVVFQENEVMVLAVDNVRHLQLINGKTGQTDYL
TEAQVSCCCLSPHLEYIAFGGEDGAIEILELLNNRIFQSRIGHKKTVRHIQFTDDGKTLI
SSSDDSSIQVWNWQSEEYVFLQAHQETVKDFRLLKNSRLLSWSFDGTVKVWSIITGRIEK
DFVCHQDTVLSCDISPDATKFSSTSADKTAKIWSFELLSPLHELRGHKGCVRCSAFSVDS
TLLATGDDNGEIRIWNVSNGELLHLCAPISVEEGAATHGGWVTDLCFSPDSKMLVSAGGY
LKWWSVDTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQMLE
NT seq 3753 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaactgtttgcttcaacatagagaagccctggaaaaggacatt
aaaacgtcctacatcatggattgtatgattaatgatggagttttaacagtatcagaggag
gaaaaagtaaaaaatgagcccactcagcagcaacgagcagctctcctaattaaaatgata
cttaaaaaagataatgattcctacatatcattctacaatgctctaatacatgaagggtat
aaatatcttgctggccttcttcatgctggcattcctgtcatctcttcttcgaatggtggc
aaagattcagttggtggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtg
ccacagaggccggtggtctttgttactaggaagaaactggtgaactcaattcagcagaac
ctcttcaaactaaatggtgaaccaggatgggtcatcatatacggaatggcaggttgtggg
aagtctgttttagctgcagaaactgttcgagatcattctttcttagatggttgtttccca
gggggtgtgcactgggtttcagttgggaaacaagacaagtctgggcttctgatgaaactg
cagaatctttgcgcacggttggatcaggatgagagtttctcccagaggcttccactcaat
attgaagaggctaaagaccgccttcgcattctgatgctgcgtaaacacccacggtctctg
ttgatcttggatgatgtttgggatccttgggtattaaaagcttttgacaatcagtgtcag
attcttattacaaccagagacaagagtgttacagattcagtaatgggccctaaatatgta
gtctctgtggagagtggcttaggaaaagaaaaaggacttgaaattttatccctttttgtt
aatatgaagaaagcagatttgccagaacaagctcacagtattataaaagaatgtaaaggt
tctcctcttgtagtgtctttaattggtgcacttttacgtgattttcccaaccgttgggat
tactaccttaggcaacttcagaataagcaatttaagagaataaggaaatcttcattttat
gattatgaggctctggatgaagccatgtctataagtgttgaaatgctcagagaggacatc
aaagattattatacagatctttccatccttcaaaaggatgttaaggtgcctacaaaggtg
ttatgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtt
aataagtctctcttattctgtgatcggaatggaaaatcattttgttattatttacatgat
cttcaagtagatttccttatagaaaagaatcgcaaccagcttcaggatctacataagaag
ttagtcactcagttccagagacatcaccagccacatactctttcaccagatcaggaggac
tgcatgtattggtacaattttctggcttaccacatggctagtgctaacatgcacaaagaa
ctttgtgctttaatgttttccctggattggattaaagcaaaaactgaactcgtaggccct
gcccatctgattcatgagtttgtggaatataggcatatattggatgaaaaggattgtgca
gtctgtgaaaatttccaagagtttttatcattaaatggacaccttcttggacgacagcca
tttcctaatattgttcaactgggtctctgtgaaccagaaacttcagaagtttatcagcaa
gctaagctgcaggccaagcaggaggtcgataatggaatgctttacctggagtggataaac
aaaaaaaacaacaagaatctttcccgcttagttgtccgcccccatacagatgctgtttac
catgcttgcttttctgaggatggtcaaagaatagcttcttgtggagttgataaaacctta
caggtgttcaaagctgaaacaggagagaaacttctggaaatcaaggctcatgaggatgaa
gtgctttgttgtgcattctctgcagatgacagattcatagcaacctgctcagtggataaa
aaagtgaagatttggaattctatgactggggaactagtacatatctatgatgagcactca
gagcaagtcaattgctgccactttaccaacaacagtcatcaccttctcttagccactgcg
tcaagtgactgtttcctcaaactgtgggatttgacccaaaaagagtgtcgaaataccatg
tttggccacacaaattcagtcaatcactgcagattttcaccagatgataaacttttggct
agttgttcagctgatggaacattaaagctttgggatgtgaaatcagcaaacgagagggaa
agcattaatgtgaagcaattcttcctaaattcagaggagcctcaagaggatatggaagtg
atagtgaaatgttgttcatggtctgctgatggtgctaggataatggtggcagcaaaaaat
aagatctttctttttgacattcatgccagtggcctgttggcagaaatccatacaggccat
catagcaccatccagtactgtgacttctccccacaaaatcacttggcagtggtggcttta
tcccagtgctgtgtagagttgtggaatatggactcatgtttaaaagtggctgactgcaga
ggacatttaagttgggttcattgtgtgatgttttctcctgatggatcatcatttttgaca
tcttctgatgaccagacaatcaggctctgggagacaaagaaagtatgtgagaactctgct
atagtgttaaagcaagaaatagatgttgtgtttcaagaaaatgaagtgatggttcttgca
gttgacaatgtaagacatctgcagctcattaatggaaaaacaggtcagactgattatctg
acagaagctcaagttagttgctgttgcttaagtccacatcttgagtacattgcatttgga
ggcgaagatggagccattgagattttagaactcctaaacaacagaatcttccaatccagg
attgggcacaagaaaactgtacggcacatccagttcacagatgatgggaaaactcttatt
tcaagctctgatgattcttcaattcaggtgtggaattggcaatcagaggaatatgtcttt
ctacaagcccatcaggaaacagtgaaagactttaggctcttgaaaaattcaagactgctt
tcctggtcatttgatggaacagtgaaggtgtggagtattattactggaagaatagaaaaa
gattttgtctgtcaccaagatacagtactttcttgtgatatttctcctgatgctactaag
ttttcatctacatctgctgacaagactgcaaagatttggagttttgaacttctttcccct
cttcatgagctgaggggccacaaaggctgtgtgcgctgctctgccttctctgtggacagt
accctgttggctactggagatgacaatggagaaatcaggatatggaatgtctcaaatggt
gagctgcttcatttatgcgctccgatttcagtagaagaaggagctgctacccatggaggc
tgggtgactgacctttgcttttcaccagatagcaaaatgcttgtctctgctggaggatat
cttaagtggtggagtgttgacactggggaatcctcacagaccttctacacaaatggaacc
aatcttaagaaaatacacgtgtctcctgacttcaaaacatatgtgactgttgataatctt
ggtattttatatattttacagatgttagagtaa

DBGET integrated database retrieval system