KEGG   Panthera tigris altaica (Amur tiger): 102965443Help
Entry
102965443         CDS       T02988                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00250  Alanine, aspartate and glutamate metabolism
ptg00410  beta-Alanine metabolism
ptg00430  Taurine and hypotaurine metabolism
ptg00650  Butanoate metabolism
ptg01100  Metabolic pathways
ptg04727  GABAergic synapse
ptg04940  Type I diabetes mellitus
Module
ptg_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    102965443 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102965443 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102965443 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102965443 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    102965443 (GAD1)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102965443 (GAD1)
Enzymes [BR:ptg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102965443 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 102965443
NCBI-ProteinID: XP_007074650
LinkDB All DBs
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSNRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaatgcgggagcggaccccaat
actaccaacctgcgccccacaacatatgacacctggtgcggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggcttcctgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaaaaacctgctttcctgtgaa
aacagcaacagggatggacgcttccggcgcacggagacggacttctccaacctgtttgct
cgagatctgcttccggctaagaacggggaagaacaaactgtgcagttcctactggaggtg
gtagacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtgctggac
ttccatcacccgcaccagctgctggaaggcatggagggcttcaacttggagctctctgac
caccctgaatccctggaacagatcttggttgactgcagagacaccctgaagtatggggtt
cgtacaggtcaccctcgatttttcaaccagctctccactggactggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtatttgtcctcatggagcaaataacacttaagaagatgagggagatagttggatggtca
agtaaagacggtgatgggatattttctcctgggggagccatctccaacatgtacagcatc
atggccgctcgctacaagttcttcccggaagttaagacaaagggcatggcagctgttccc
aaactggtcctcttcacctcagaacatagtcactattccataaagaaggctggagctgca
cttggctttggaaccgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
ccagctgatttagaggcaaaaattcttgaagccaagcaaaagggatacgttcccctttat
gtcaatgcaactgctggtacaactgtttatggagctttcgatccgatacaggagattgca
gatatatgtgagaaatacaacctgtggctacatgtcgacgctgcctggggcggtgggctg
cttatgtccaggaagcaccgccacaaactcagtggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctcggccatcctcgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggataccttttccagccagacaaa
cagtatgatgtctcctatgacactggggacaaggcaatccagtgtggccgccacgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggagctggctgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgatggtgagcctgagcatacaaatgtctgtttctggtatattccacaa
agcctcaggggcattccagatagccctgaacgacgggaaaaactacacagggtggccccc
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagccccagggg
gacaaggccaactttttccggatggtcatctcgaacccagctgctacacagtctgatatt
gacttcctcatcgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system