KEGG   Panthera tigris altaica (Amur tiger): 102965640
Entry
102965640         CDS       T02988                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04022  cGMP-PKG signaling pathway
ptg04141  Protein processing in endoplasmic reticulum
ptg04151  PI3K-Akt signaling pathway
ptg04211  Longevity regulating pathway
ptg04261  Adrenergic signaling in cardiomyocytes
ptg04668  TNF signaling pathway
ptg04728  Dopaminergic synapse
ptg04911  Insulin secretion
ptg04915  Estrogen signaling pathway
ptg04918  Thyroid hormone synthesis
ptg04925  Aldosterone synthesis and secretion
ptg04926  Relaxin signaling pathway
ptg04927  Cortisol synthesis and secretion
ptg04928  Parathyroid hormone synthesis, secretion and action
ptg04934  Cushing syndrome
ptg04935  Growth hormone synthesis, secretion and action
ptg05020  Prion disease
ptg05030  Cocaine addiction
ptg05031  Amphetamine addiction
ptg05034  Alcoholism
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102965640 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102965640 (ATF6B)
   04022 cGMP-PKG signaling pathway
    102965640 (ATF6B)
   04151 PI3K-Akt signaling pathway
    102965640 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102965640 (ATF6B)
   04915 Estrogen signaling pathway
    102965640 (ATF6B)
   04926 Relaxin signaling pathway
    102965640 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    102965640 (ATF6B)
   04918 Thyroid hormone synthesis
    102965640 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    102965640 (ATF6B)
   04925 Aldosterone synthesis and secretion
    102965640 (ATF6B)
   04927 Cortisol synthesis and secretion
    102965640 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102965640 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    102965640 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    102965640 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    102965640 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    102965640 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    102965640 (ATF6B)
   05031 Amphetamine addiction
    102965640 (ATF6B)
   05034 Alcoholism
    102965640 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102965640 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102965640 (ATF6B)
   05161 Hepatitis B
    102965640 (ATF6B)
   05163 Human cytomegalovirus infection
    102965640 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102965640 (ATF6B)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    102965640 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 102965640
NCBI-ProteinID: XP_007093342
LinkDB
Position
Un
AA seq 734 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRSTLYTGLDDVAEEQTQLFRCPEQDVPFGSS
SLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSQVPAVGEV
LVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDPSVIISEEGSRWLVDKKGKEIHFT
ELPFGPLEFYVQTKLEPVSPSSSINSEASLLSAESPNQGFIGEEVLEVKTESPSPQGCLL
RDVLGPPLGGVQISMGPSSDGSLGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQ
PLVQPPPVSPVVLIQGAIRVQPEGPAPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQ
RMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAALRRRLEALLAENSELKL
GSGNRKVVCIMVFLLFIAFNFGPVSISDPPPAPISPRMSGEEPRPRRHLLEFSAQEPVHG
VEPLQGSSLGPEEPQPSPPGRPSFRNLTAFPGGSAKELLLRDLDQLFLSSDCRHFNRTES
LRLADELSGWVQRHQRGRRKIPQRAQERQKSQLWKKSPPVKAVPTQPPGPPERDSVGQLQ
LYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNET
LSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQ
ARQASHQPLYLNHP
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggcggaactgatgctgctcagcgagattgcggacccaacacgttttttcaccgataac
ttgctgagcccggaggactggggtctgcggagcaccttgtatactggcttagatgatgtc
gcggaggagcagacgcagctcttccgttgcccagagcaggatgtcccgtttggcagcagt
tccctggatgtggggatggatgtcagccctcctgagccaccctgggaccccctgcctatc
tttccagaccttcaggtgaagtctgagccatcctccccctgctcctcttcctccctcagc
tctgaatcatcgcgtctttccacagagccctctagccaggtccctgctgtaggggaggtg
ctggttgtgaagacagagtccttggcacccccactctgcctcctaggagatgatccaaca
tccccatttgaaacggtccagatcaatgtgggtcccacctctgatgacccctcagtgatc
atctctgaggagggatccaggtggctggtagacaagaaagggaaggagatccacttcact
gaattaccttttggtcctttggagttttatgtccagaccaagctagagcctgtctctcca
tcttcctccatcaactctgaggcttccctgctctcagcagagtcccccaaccagggtttt
ataggagaggaggtactggaagtgaagacagagtcaccatcccctcaagggtgtctcctg
cgggatgtcctaggccccccacttggaggtgtccagatcagcatgggcccatcctccgat
ggctccttaggcaaagccctgcccacccgaaagccaccgctgcagcccaaacctgtggtg
ataaccactgtcccaatgccacccagagctgtgcctcccagcaccaccatccttttgcag
cctcttgtccaaccacccccagtgtcaccagttgtcctcatccaaggtgctattcgggtc
cagcctgaggggccggccccccctgctccaaggcctgaaaggaagagcattgttccagct
cctatgcctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcag
cgaatgatcaagaaccgggagtcggcctgccagtccaggaggaagaagaaggagtatctg
caggggctggaggctcggctgcaggctgtgctggccgacaaccagcagctccgcagggag
aatgctgccctccggcggcggctggaggccctgctggccgaaaacagcgagctcaagtta
gggtctggaaacaggaaggtggtctgcatcatggtgttccttcttttcattgccttcaac
tttggacctgtcagcatcagtgaccctcctccagctcccatctctcctcggatgagcgga
gaggagcctcgaccccggagacacttgctggagttctcagcgcaagagccggttcatgga
gttgaacccctccagggttcctccctgggccctgaggagccccagcccagccccccaggc
cggccaagtttcaggaacctgacagccttcccggggggcagtgccaaggagctgctgctg
agagacctggaccagctcttcctctcctctgattgccggcacttcaaccgaaccgagtcc
ctgaggcttgcggacgagctgagcggctgggtccagcgtcaccagagaggccggcggaag
atcccccagagggcccaggagagacagaagtctcagctctggaagaagtcgcctccagtt
aaggcagttcccacccaaccccctgggcccccagaaagggattctgtgggccaactgcag
ctatatcgccacccagaccgttcgcagccagagttcctggatgcaattgaccgacgagaa
gacacattttatgttgtgtccttccgaagggaccacttgctgctccctgccatcagccac
aacaagacctctcggcccaagatgtccctggtgatgcctgccatggcccccaatgagacc
ctgtcaggccggggggctccaggagactatgaggagatgatgcagatcgagtgtgaggtc
atggacacccgggtgattcacatcaagacctccacggtgcctccctcgctccgaaaacag
ccatcctcgaccccaggcaatgccacaggtggccccttgccagcttctgcagccggccag
gcacgccaggcctcccaccagcccctctacctcaatcacccctga

DBGET integrated database retrieval system