KEGG   Panthera tigris altaica (Amur tiger): 102965656
Entry
102965656         CDS       T02988                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg04012  ErbB signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04151  PI3K-Akt signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg04934  Cushing syndrome
ptg05162  Measles
ptg05165  Human papillomavirus infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05206  MicroRNAs in cancer
ptg05215  Prostate cancer
ptg05220  Chronic myeloid leukemia
ptg05222  Small cell lung cancer
ptg05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102965656 (CDKN1B)
   04066 HIF-1 signaling pathway
    102965656 (CDKN1B)
   04068 FoxO signaling pathway
    102965656 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    102965656 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102965656 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102965656 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    102965656 (CDKN1B)
   05206 MicroRNAs in cancer
    102965656 (CDKN1B)
   05203 Viral carcinogenesis
    102965656 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    102965656 (CDKN1B)
   05220 Chronic myeloid leukemia
    102965656 (CDKN1B)
   05215 Prostate cancer
    102965656 (CDKN1B)
   05222 Small cell lung cancer
    102965656 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102965656 (CDKN1B)
   04934 Cushing syndrome
    102965656 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    102965656 (CDKN1B)
   05169 Epstein-Barr virus infection
    102965656 (CDKN1B)
   05165 Human papillomavirus infection
    102965656 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102965656 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102965656
NCBI-ProteinID: XP_007076365
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGNRQAVPLIG
SQANTEDTHLVDQKTDTSDNQTGLAEQCPGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctctgcctgcaggaacctcttcggcccggtcaaccacgaagag
ttgacccgggacttggagaagcactgcagagacatggaagaggcaagccagcgcaagtgg
aattttgatttccagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcagcttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggaaccgccaggcggtgcctttaattggg
tctcaggcaaacacagaggacacacatttggtagaccaaaagactgatacatcggacaac
cagacggggttagcggagcagtgccctgggataaggaagcgacctgctacagatgattcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtctcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagcctggcctgagaagacgtcaaacgtaa

DBGET integrated database retrieval system