KEGG   Panthera tigris altaica (Amur tiger): 102965713
Entry
102965713         CDS       T02988                                 

Gene name
XPA
Definition
(RefSeq) XPA, DNA damage recognition and repair factor
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    102965713 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102965713 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102965713 (XPA)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     102965713 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N zf_C2H2_13 DZR Zn-ribbon_8 zf-dskA_traR Ion_trans_N
Other DBs
NCBI-GeneID: 102965713
NCBI-ProteinID: XP_015396200
LinkDB
Position
Un
AA seq 229 aa
CGRSRRRGVPASVGVANVKAAPKITDTGGGFILEEEEEEQCTIGKVVHQPGPVMEFDYAI
CEECGKEFMDSYLMNHFDLATCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPALKF
IVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEIRQENREKMRQKKFDKKVK
ELRRAVRSSVWKRETVAHQHEYGPEESLEEDTYRKTCTMCGHELTYEKM
NT seq 690 nt   +upstreamnt  +downstreamnt
tgcggccgctctcgccgtcggggggtaccagccagtgtcggcgtggctaatgtaaaagca
gccccaaagatcaccgacacaggaggaggcttcattctagaagaggaagaagaggaacag
tgtacaattggaaaagttgtccatcaaccaggacctgttatggaatttgattatgcgata
tgtgaagaatgtggtaaagaatttatggattcttaccttatgaaccactttgatttggca
acttgtgacaactgcagagatgctgatgataaacacaagctcataactaaaacagaagcc
aaacaagaataccttctgaaagactgtgatttagaaaaaagagaaccagctcttaaattc
attgtgaagaagaatcctcatcattcacaatggggtgatatgaaactctacttaaaattg
cagattgtgaagcggtctcttgaagtttggggcagtcaggaagcattagaagaagcaaag
gaaattcgacaagaaaaccgagaaaaaatgagacagaaaaagtttgataagaaagtaaaa
gaattacggcgagcggtgagaagcagcgtgtggaaaagggaaacagttgctcatcagcat
gagtatggaccagaagaaagcctagaggaggatacgtaccggaagacttgtaccatgtgt
ggccacgagctgacctatgagaaaatgtga

DBGET integrated database retrieval system