KEGG   Panthera tigris altaica (Amur tiger): 102965880
Entry
102965880         CDS       T02988                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01522  Endocrine resistance
ptg01524  Platinum drug resistance
ptg04068  FoxO signaling pathway
ptg04110  Cell cycle
ptg04115  p53 signaling pathway
ptg04120  Ubiquitin mediated proteolysis
ptg04144  Endocytosis
ptg04151  PI3K-Akt signaling pathway
ptg04218  Cellular senescence
ptg04625  C-type lectin receptor signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05169  Epstein-Barr virus infection
ptg05200  Pathways in cancer
ptg05202  Transcriptional misregulation in cancer
ptg05203  Viral carcinogenesis
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05218  Melanoma
ptg05219  Bladder cancer
ptg05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102965880 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102965880 (MDM2)
   04151 PI3K-Akt signaling pathway
    102965880 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102965880 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102965880 (MDM2)
   04115 p53 signaling pathway
    102965880 (MDM2)
   04218 Cellular senescence
    102965880 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102965880 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102965880 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102965880 (MDM2)
   05202 Transcriptional misregulation in cancer
    102965880 (MDM2)
   05206 MicroRNAs in cancer
    102965880 (MDM2)
   05205 Proteoglycans in cancer
    102965880 (MDM2)
   05203 Viral carcinogenesis
    102965880 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    102965880 (MDM2)
   05220 Chronic myeloid leukemia
    102965880 (MDM2)
   05218 Melanoma
    102965880 (MDM2)
   05219 Bladder cancer
    102965880 (MDM2)
   05215 Prostate cancer
    102965880 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102965880 (MDM2)
   05169 Epstein-Barr virus infection
    102965880 (MDM2)
   05165 Human papillomavirus infection
    102965880 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102965880 (MDM2)
   01522 Endocrine resistance
    102965880 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102965880 (MDM2)
   04121 Ubiquitin system [BR:ptg04121]
    102965880 (MDM2)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102965880 (MDM2)
Membrane trafficking [BR:ptg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102965880 (MDM2)
Ubiquitin system [BR:ptg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102965880 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS Tyrosinase
Other DBs
NCBI-GeneID: 102965880
NCBI-ProteinID: XP_007082291
LinkDB
Position
Un
AA seq 491 aa
MCNTNMSVSTDGAVSTSQMPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQHEPSDSGT
SVSENRCHLEGGSDQKDPVQELQEEKPSSSDLVSRPSTSSRRRTISETEEHSDELPGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGKMPEKAKVENSTQVEEGFDVP
DCKKTTVNDSRESCAEENDDKITQASQSQESEDYSQPSTSNSIIHSSQEDVKEFEREETQ
DKEEIVESSFPHNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctaccgatggtgctgtaagcacctcacagatgcca
gcttcggaacaagagaccctggttagaccaaagccattgctcttgaagttgttaaagtct
gttggtgcacaaaaagacacttacactatgaaagaggttatattttaccttggccagtat
attatgactaaacgattatatgatgagaagcaacagcatattgtgtattgttccaatgat
ctcctaggggatttgtttggagtgccaagcttctctgtgaaagaacacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcatgaaccatcagattcaggcaca
tctgtgagtgaaaataggtgtcaccttgaaggtgggagtgatcaaaaggaccctgtgcaa
gagttgcaggaagagaaaccttcatcttcagatttggtttctagaccatctacctcatct
agaaggagaacaattagtgagacagaagaacattcagatgaattacctggtgaacggcag
agaaagcgccacaagtctgatagtatttctctttcctttgatgaaagccttgctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagcgaatcgacggggactccgtca
aatccggatctcgatgctggtgtaagtgaacattcaggtgattggttggatcaggattca
gtttcagatcaattcagtgtagaatttgaagttgagtctctcgattcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagtaactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaagtgtacttcgtgcaatgaaatgaatcctcctcttccacctcattgcaac
agatgttgggctcttcgtgagaattggcttcctgaagataaagggaaagataaagggaaa
atgcctgagaaagccaaagtggaaaactcaacacaagtagaagagggctttgatgtccct
gattgtaaaaaaactacagtgaatgattctagggaatcatgtgctgaggaaaatgatgat
aaaatcacacaggcctcccaatcccaagaaagtgaggactattctcagccatcaacttct
aacagcatcattcatagcagccaagaagatgtcaaagagtttgagagggaagaaacacag
gacaaagaagaaatcgtggaatctagttttccccataatgccattgaaccttgtgtgatt
tgccagggtcgacctaaaaatggttgcattgttcatggcaaaacaggacatcttatggca
tgctttacttgtgcaaaaaagctaaagaagaggaataagccctgtccagtatgtagacaa
ccaattcaaatgattgtgttaacttatttcccctag

DBGET integrated database retrieval system