KEGG   Panthera tigris altaica (Amur tiger): 102965910
Entry
102965910         CDS       T02988                                 

Gene name
PYCARD
Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04217  Necroptosis
ptg04621  NOD-like receptor signaling pathway
ptg04623  Cytosolic DNA-sensing pathway
ptg04625  C-type lectin receptor signaling pathway
ptg05132  Salmonella infection
ptg05133  Pertussis
ptg05134  Legionellosis
ptg05135  Yersinia infection
ptg05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102965910 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102965910 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    102965910 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    102965910 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102965910 (PYCARD)
   05135 Yersinia infection
    102965910 (PYCARD)
   05133 Pertussis
    102965910 (PYCARD)
   05134 Legionellosis
    102965910 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    102965910 (PYCARD)
SSDB
Motif
Pfam: CARD PYRIN YqzH
Other DBs
NCBI-GeneID: 102965910
NCBI-ProteinID: XP_007092244
LinkDB
Position
Un
AA seq 195 aa
MGCTRDAILDALENLTAEEFKKFKLKLLSVPLREGYGRIPRGPLLSMDAMDLTDKLVSSY
LEEYGAELTALVLRDIGMKELSERLQQITRKDQAAAPAGIQDSHLKAAKPAMHFVDQHRM
ALITRVTDVDGVLDALYGKVLTEELYQAVRAEPTNALKMRKLFSFTPAWNVTCKDLLLQA
LRDTQPYLVLDLEQS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggtgcactcgcgacgccatcctggacgcactggagaacctgaccgcagaggagttc
aagaagttcaagctgaagctgctttcagtgcccctgcgcgaaggctatgggcgcatcccg
cgggggcccctgctgtccatggacgccatggacctcacagacaagctggtctcttcctat
ctggaagagtacggcgcagagctcacggcgcttgtgctgcgcgacattggcatgaaagag
ctatcagagcggctgcagcagatcacgcgcaaagaccaggcagccgcacctgctgggatc
caggattctcacctgaaggcagccaagccagcaatgcactttgtggaccagcaccggatg
gcccttatcacacgggtcacagatgtggacggggtgctggatgccctgtacggaaaggtc
ctgacagaggagctgtaccaggcagtgcgagcagagcccaccaatgcactgaagatgagg
aaactcttcagcttcactccagcctggaacgtgacctgcaaagatctgctccttcaggct
ctgagggacacccagccctacctggtgcttgacctggagcaaagctga

DBGET integrated database retrieval system