Panthera tigris altaica (Amur tiger): 102965935 Help Entry 102965935         CDS       T02988                                  Symbol MAX Name (RefSeq) MYC associated factor X   KO K04453   Max protein Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03083   Polycomb repressive complex ptg04010   MAPK signaling pathway ptg05200   Pathways in cancer ptg05202   Transcriptional misregulation in cancer ptg05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     102965935 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102965935 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102965935 (MAX)    05202 Transcriptional misregulation in cancer     102965935 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     102965935 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ptg03000]     102965935 (MAX)    03036 Chromosome and associated proteins [BR:ptg03036]     102965935 (MAX) Transcription factors [BR:ptg03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     102965935 (MAX) Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      102965935 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH JetA Filament bZIP_2 JAKMIP_CC3 SlyX Jnk-SapK_ap_N DUF5595 GAGA_bind SLX9 Motif Other DBs NCBI-GeneID:  102965935 NCBI-ProteinID:  XP_015398893 LinkDB All DBs Position Un AA seq 203 aa AA seqDB search MQFLMGFVVLLAPAGPSVKGATTTSLGGPSVTGPVTWQGADRACVPPLIRCCSEEEEQPR FQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQILDKATEYIQYMRRK NHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGG SDSSSESEPEEPQSRKKLRMEAS NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgcagttccttatgggatttgtagttttactggctccagctgggccgtcagtcaaaggg gcgacaactacaagtctcggcggccccagcgtgacgggcccggtcacgtggcagggggcc gaccgggcgtgcgtgccgccgttgatccggtgctgcagtgaggaggaagagcaaccgagg tttcaatctgcggctgacaaacgggctcatcataacgcactggaacgaaaacgtagggac cacatcaaagacagctttcacagtttgcgggactcggtcccatcactccaaggagagaag gcatcccgggcccaaatcctagacaaagccacagagtatatccagtatatgcgaaggaaa aaccacacacaccagcaagatatcgatgacctcaagcggcagaatgctctcctggagcag caagtccgtgcactggagaaggcgaggtcgagtgcccaactgcagaccaactacccctcc tcagacaacagcctctacaccaacgccaagggcagcaccatctctgccttcgatggaggc tcagactccagctcggagtcggagcccgaagagccccaaagcaggaagaagctccggatg gaggccagctaa

DBGET integrated database retrieval system