KEGG   Panthera tigris altaica (Amur tiger): 102965986Help
Entry
102965986         CDS       T02988                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04614  Renin-angiotensin system
ptg04924  Renin secretion
ptg05142  Chagas disease (American trypanosomiasis)
ptg05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    102965986
   04614 Renin-angiotensin system
    102965986
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102965986
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    102965986
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ptg01002]
    102965986
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102965986
   04090 CD molecules [BR:ptg04090]
    102965986
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102965986
Peptidases [BR:ptg01002]
 Metallo Peptidases
  Family M2
   102965986
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102965986
CD molecules [BR:ptg04090]
 Proteins
  102965986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 102965986
NCBI-ProteinID: XP_015395763
LinkDB All DBs
Position
Un
AA seq 718 aa AA seqDB search
MNRIYSTAKVCYYPNKTAICWSLDPELTHIMAISRSYSVLLYAWEGWHNAVGIPLKPLYQ
NFTALSNEAYKQDGFSDTGAYWRSWYDSPTFVEDLEHLYHQVEPLYLNLHAYVRRALHRR
YGDRYINLRGPIPAHLLGDMWAQSWDNLYDMVVPFPNKPSLDVTSTMVKKGWNITHMFRV
AEEFFTSLGLLPMPPEFWTRSMLEKPTDGRQVVCHASAWDFYNRKDFRIKQCTRVTMDQL
STVHHEMGHVQYYLQYKDQPVSLRQGANPGFHEAIGDVLALSVSTPEHLYKIGLLDNVSN
DMESDINYLLKMALEKIAFLPFGYLVDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICAP
IARNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQFHQALCKEAGHQGPLHKCDIYQSTQA
GAKLREALRSGSSRPWQEVLKEAIGSDTLDAQPLLNYFQPVSRWLQEQNQRNGEVLGWPE
YQWRPPVPHNYPQDIGLVTDEVEARKFVEEYDRRSQVIWNEYAEANWNYNTNITTEASKI
LLQKNIQMANHTLKFGTWARQFDMTSFQNDSIKRMMKKIQDLERAALPAKELEEYNQILL
DMETTYSVASVCHANGTCLQLEPDLTNLMATSRKHEDLLWAWESWRDKVGRAILPFFPKY
VELANKAAKLNGYEDAGDSWRAMYEMPTLERDLEQLYQELQPLYLNLHAYVRRDLHRN
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggatctattccacggccaaggtctgctactatcccaacaagactgccatctgc
tggtccctggacccagagctcacccacatcatggctatatcaagaagctactccgtgctg
ctctatgcctgggagggctggcacaacgctgtgggcatcccactgaaacccctgtaccag
aacttcactgccctcagcaatgaggcctacaagcaggatggcttctcagacacgggggcc
tactggcgctcctggtatgactcacccaccttcgtggaggatctggaacacctctaccat
caagtagagcccctctacctgaacctccatgcctatgtccgccgtgcgctgcaccgccga
tatggggacagatacatcaacctcaggggacccatccctgctcacctgctgggggacatg
tgggcccagagctgggacaacctctatgatatggtggtgccttttcctaacaagcccagt
ctcgacgtgaccagcactatggtgaagaagggctggaacattacgcacatgttccgagtg
gcagaggaattcttcacctccctggggctcttgcccatgcctcctgagttttggacaagg
tccatgctggagaaaccaaccgatgggcgtcaggtggtgtgccacgcctctgcctgggac
ttctacaacaggaaagacttcaggatcaagcagtgcacgcgggtcactatggaccagctg
tccacggtgcaccacgagatgggccacgtgcagtactatctgcagtacaaggaccagcct
gtctccctgcgccaaggggccaaccctggcttccacgaggccatcggggatgtgctggcg
ctctccgtctccactcctgaacatctgtacaaaattggcctgctggacaatgtcagcaat
gacatggaaagtgacatcaattacttgttaaagatggcactggaaaaaattgccttcctg
ccctttggctacttggtggaccagtggcgctggggggtctttagtgggcgaacccctcct
tcccgctacaactttgactggtggtatcttcgaaccaagtatcagggaatctgtgctcca
attgcccgaaatgaaacgcactttgatgccggagctaagtttcatgtcccaaatgtaaca
ccgtacatcaggtactttgtgagttttgtgctgcaattccagttccatcaagccctgtgc
aaggaggcgggtcaccaaggcccactgcacaagtgcgacatctaccagtccacccaggcg
ggggccaagctcagggaggcgctgcggtcaggctcctcacggccctggcaggaggtgcta
aaggaggcgattggctcagatacactggatgctcaacctctgctcaactacttccagccg
gtcagccggtggctgcaggagcagaatcagcgcaacggcgaagtgctggggtggccggaa
taccagtggcggccaccagtaccccacaattacccacaggacattggcctggtgaccgat
gaggtggaggctagaaagtttgtggaggaatatgaccgaagatcccaggtgatatggaat
gagtatgctgaggctaactggaactataacaccaacatcaccacagaggccagcaagatc
ctgctacagaagaacatacagatggcaaaccacaccttgaagttcggcacctgggccagg
cagtttgatatgaccagcttccagaatgacagcattaagcggatgatgaagaagattcag
gacctagagcgggcagcactgcctgccaaggagctggaggagtacaaccagatcctgctg
gacatggaaaccacttacagcgtggcctctgtgtgccacgccaatggcacttgtctgcag
ctggagcctgatctgacgaatctgatggccacgtcccggaaacatgaagatctgttgtgg
gcctgggagagctggcgagacaaggtggggagagcaatcctcccctttttccccaaatat
gtggaacttgccaacaaggctgccaagctcaatggctacgaagatgcaggtgactcctgg
agagccatgtacgagatgccaaccctggaacgcgacctggagcagctctaccaggagctg
cagccgctctacctgaacctgcacgcctacgtgcgccgggacctgcaccgcaactaa

DBGET integrated database retrieval system