KEGG   Panthera tigris altaica (Amur tiger): 102966015
Entry
102966015         CDS       T02988                                 

Gene name
FCER1G
Definition
(RefSeq) Fc fragment of IgE receptor Ig
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04071  Sphingolipid signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04611  Platelet activation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04664  Fc epsilon RI signaling pathway
ptg05152  Tuberculosis
ptg05310  Asthma
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102966015 (FCER1G)
   04071 Sphingolipid signaling pathway
    102966015 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102966015 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    102966015 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    102966015 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    102966015 (FCER1G)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    102966015 (FCER1G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102966015 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102966015 (FCER1G)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102966015 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 102966015
NCBI-ProteinID: XP_007093106
LinkDB
Position
Un
AA seq 130 aa
MLSRPCAEPSGSDPERKLQCLSPRSLPARPRPTCRSPFPSVPWCQIFPDAPTPRAPSIPS
AALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAIASYEKSDGIYTGLSTRNQETY
ETLKHEKPPQ
NT seq 393 nt   +upstreamnt  +downstreamnt
atgctctcccggccgtgcgcagagccatcgggatctgatccagagaggaagctccagtgt
ctctctcctcggagcctccccgccaggccccgtcctacctgccggagccccttcccttct
gtcccctggtgccagatcttccctgatgccccgacccctcgggccccctctatcccctca
gccgccctgggagagcctcagctctgctatatcttggatgccatcctgttcttgtatggt
attgtcctcaccctgctctactgccgactcaagatccaggtgcggaaggcggcgatagcc
agctatgagaaatcagatggcatttacacgggcctgagcacccggaaccaggagacttat
gagaccctgaagcatgagaaaccaccccagtaa

DBGET integrated database retrieval system