KEGG   Panthera tigris altaica (Amur tiger): 102966279Help
Entry
102966279         CDS       T02988                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04614  Renin-angiotensin system
ptg04924  Renin secretion
ptg05142  Chagas disease (American trypanosomiasis)
ptg05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    102966279
   04614 Renin-angiotensin system
    102966279
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102966279
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102966279
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102966279
Peptidases [BR:ptg01002]
 Metallo Peptidases
  Family M2
   102966279
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102966279
CD molecules [BR:ptg04090]
 Proteins
  102966279
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Mtc CopD
Motif
Other DBs
NCBI-GeneID: 102966279
NCBI-ProteinID: XP_015395748
LinkDB All DBs
Position
Un
AA seq 748 aa AA seqDB search
HGPSLFVLFCYGQLLPWLRTEGDQNLDKFCNETVAKMFLQFYEHTAQVVWNQFMEATWNY
VTNITKKNREEMLHKDSERSQNVPYFGTWARLFKISRFQDPAMKRMLSKLQNIDKAALPQ
DELREYNMLLAYMETTYSMAQVCLNEGPCLPLEPDLEEVMATSRDEKELLWAWQGWRDAV
GHQLCITFKRYVQLSNRTAKLNGYKDMGALWRSXESDTLEHDLEQLYRELQPLYLNLHTY
MCRALHRHYGSELINPRGPIPAHLLRNMWAQFWVNILDLVLPFPKKPLEDITKIMKSQHW
KPSKMFEGAEKFFTSLGLLSTPPNFWKTSMMERPTDGREVECHASAWDFYNGKDVRVKKC
TEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFRAGANPAFEEAVGSMVTLSASSHKYLLNR
GLLSHQHQDSEEEVNFLMGIALEKIAFIPFAYLMDLFRWKVFDGTIRKDVYNQEWWNLRL
KYQGLCPPIPQTEDYFDPGAKFHISASMPYIRXQYFISLVLQFQFHAALASGHVGPLHRC
DSYNSKIAEKLLEDVLKLGSSKPELFWPEVLQKITGQAKVSAKALMTYFKPLLNWLVTEN
VRQGEILGWPDFSCTFEEKDTDKVTFLSLELDADQAKFGQWVLLALSFVMFLVALLLACR
LYSLEKRSLSQNTKAQNTGSQDSSALKTQPKAYFLGIAMEPCLVAKRQWILLGLCLILTL
CSISLIIQILTQHNRKPLWMRAEWWSWD
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
catggaccttccttatttgtgctcttctgttatgggcagctcttgccatggctcaggacc
gagggtgatcagaacttagacaagttctgcaatgagaccgtggcaaagatgttcctgcag
ttttatgagcataccgcccaggttgtatggaaccagttcatggaggccacctggaactat
gtcaccaacatcaccaagaaaaaccgggaggagatgctgcacaaagactcagagaggtcc
cagaacgtgccgtactttggcacttgggcccgcctgtttaagatctccaggttccaggac
ccggccatgaagcgcatgctgagtaagctgcagaacatagacaaggcggccctgccccag
gacgagctccgggagtacaacatgcttctggcctacatggagacgacatacagcatggcc
caggtgtgcctgaatgagggaccctgcctacccctggagcctgaccttgaagaagtcatg
gccacctcccgggacgagaaagagctgctgtgggcctggcagggctggcgggatgctgtg
ggtcatcagctttgcatcaccttcaagcgctatgtgcagctcagcaacaggactgcaaag
ctcaacggttacaaagacatgggggccttgtggcggtccnaagagtctgacaccctggaa
cacgacctggagcagctttaccgggagctgcagccactctacctaaacctgcacacatac
atgtgccgggccctgcaccgccactacgggtcagagcttatcaacccgcggggacccatc
cctgcccacctcctgaggaacatgtgggctcagttctgggtcaacatcttagacctggtc
ctgcccttcccaaagaagcctcttgaggacatcacaaaaatcatgaaaagccagcactgg
aagccctcaaaaatgttcgaaggggctgaaaaattcttcacctccctggggctgctttcc
acccctcccaacttctggaaaacttcaatgatggaaaggccaactgatgggcgagaggtg
gagtgccacgcctctgcctgggacttctacaacggcaaggacgtcagggtaaagaagtgc
accgaggtgaccatagaagacctgctctccatcttccaccagatgggccatatccagtac
ttcttgcagtacaagaacctctctgtgatcttccgtgcaggagccaacccagcctttgaa
gaggccgtggggtcgatggtcaccctctcggcctcctcccacaaatacctgctcaaccga
ggcctgctcagccaccagcaccaggactcagaggaggaggtcaatttcctgatgggcatc
gccctggagaagatcgcctttatccccttcgcctacctgatggacctgtttcgctggaag
gtctttgatggcaccatccggaaggacgtctacaaccaggagtggtggaacttgaggttg
aagtaccagggcctgtgcccccccatccctcagacagaggattactttgatcctggtgcc
aagttccacatttctgccagcatgccctacatacgataacagtacttcatcagcctagta
ctccagttccagttccacgccgctctggcctcaggccatgtgggcccattgcaccgatgt
gacagctataactccaagatagctgagaagctcctggaggatgtcctaaagctgggctca
agcaagccagaactcttctggccagaagtcttgcagaagataaccgggcaggccaaagtg
tctgcaaaggccctcatgacttacttcaagcccctcttgaactggctggtcactgagaat
gtgcggcagggggagatcctgggctggccagacttcagctgtacctttgaagagaaagac
acagacaaggtgacatttctgagtctggagctggacgctgaccaggccaaatttgggcag
tgggtgctgctggccctcagctttgtcatgttcctggtggccctactgctggcctgcagg
ctgtactccctggaaaaaaggtcattgtcccagaacaccaaggcacagaacaccggttca
caggactccagtgcactcaagacacagcccaaggcctacttcctggggatagccatggag
ccctgcctggttgccaaaagacagtggatcctgctgggcctctgcctcatcctgacgctg
tgctcaatcagcctgatcattcaaattctcacacagcacaacaggaagcctctgtggatg
agagctgaatggtggagctgggactag

DBGET integrated database retrieval system