KEGG   Panthera tigris altaica (Amur tiger): 102966376
Entry
102966376         CDS       T02988                                 

Gene name
BRCA1
Definition
(RefSeq) BRCA1, DNA repair associated
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01524  Platinum drug resistance
ptg03440  Homologous recombination
ptg03460  Fanconi anemia pathway
ptg04120  Ubiquitin mediated proteolysis
ptg04151  PI3K-Akt signaling pathway
ptg05206  MicroRNAs in cancer
ptg05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102966376 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    102966376 (BRCA1)
   03460 Fanconi anemia pathway
    102966376 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102966376 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    102966376 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    102966376 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102966376 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ptg01009]
    102966376 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ptg04121]
    102966376 (BRCA1)
   03036 Chromosome and associated proteins [BR:ptg03036]
    102966376 (BRCA1)
   03400 DNA repair and recombination proteins [BR:ptg03400]
    102966376 (BRCA1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102966376 (BRCA1)
Protein phosphatases and associated proteins [BR:ptg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102966376 (BRCA1)
Ubiquitin system [BR:ptg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102966376 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    102966376 (BRCA1)
Chromosome and associated proteins [BR:ptg03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     102966376 (BRCA1)
DNA repair and recombination proteins [BR:ptg03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     102966376 (BRCA1)
    BRCA1-A complex
     102966376 (BRCA1)
    BRCA1-B complex
     102966376 (BRCA1)
    BRCA1-C complex
     102966376 (BRCA1)
    BRCA complex
     102966376 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     102966376 (BRCA1)
SSDB
Motif
Pfam: BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-Nse zf-RING_5 BRCT_2 zf-RING_6 zf-ANAPC11 zf-RING_10 Prok-RING_4 zf-rbx1 Baculo_IE-1 RTT107_BRCT_5 zf-RING_4
Other DBs
NCBI-GeneID: 102966376
NCBI-ProteinID: XP_015395516
LinkDB
Position
Un
AA seq 765 aa
MDLSADRVEEVQSVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQRKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLNIIHAFELDTGLQFANSYNFSKKENNSPEHLKE
EVSIIQSMGYRNRAKRLRQSEPENPSLETSLSVQLSNFGIVRSLRTKQQIQPQNKSVYIE
LGSDSSEDTVNKASYFSVGDDELLGITPQGARAEASLNPAKKASCEFSEEITNIEHRQPS
NKDLTTTEKHATEKHPEKYQGEAASGYESETSLSEDCSGVSSQSDILTTQQRDTMQDNLI
KLQQEMAELEAVLEQHESQPSNSSPALITDSYAPEDLFNPEQNTSEKAVLTSEKSSDCLI
SQNPESLSADKFQVSLDSSTSKTKEPGMRRSSPSQSRLLDTRQCVHSHSSSLQSTNCLSQ
KELIKAVDGEELQLTKSEPRDFMEQSYMPRQDLEGTPYFESGISLFSDDPESDLSVDRAP
EPVHVSSMPTSTSALKLPQFQVEESAKSTAAVHITNTAGYNKREDIEGKEKPETMSSTKR
VNKRISMVASGLTPKELVLVQKFARRHQITLTNVISEETTHVIMKTDAEFVCERTLKYFL
GIAGGKWVVSYFWVTQSIKERKMLDEHDFEVRGDVVNGRNHQGPKRARESRDRKIFGGLE
ICCYGPFTNMPTDQLEWMVRLCGASVVKRPSLFTLSKATHPVVVVQPDAWTEDSGFHAIG
QMCEAPVVTREWVLDSVALYQCQELDTYLIPQIPRATADLSQPCV
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggatttatctgcagatcgtgttgaagaagtacaaagtgtccttaatgctatgcagaaa
atcttagagtgtccaatctgtctggagttgatcaaagagcctgtttccacaaagtgtgat
cacatattttgcaaattttgtatgctgaaacttctcaaccagaggaaagggccttcacag
tgtcctttgtgtaagaatgatataaccaaaagaagcctacaggaaagtacaagatttagt
caacttgttgaagagctgttgaacatcattcatgcttttgagcttgacacaggattgcag
tttgcaaacagctataacttttcaaaaaaggaaaataactctcctgagcatctgaaggag
gaggtttctattatccaaagtatgggctatcgaaaccgtgctaaaagacttcgacagagt
gaacctgaaaaccctagcttggaaaccagtcttagtgtccaactctctaactttggaatt
gtgagatctctgaggacaaagcagcagatacaaccacagaataagtctgtctacattgaa
ttgggatctgattcttctgaagatacagtgaataaggcaagttatttcagtgtgggagat
gacgaattgttaggaatcacccctcaaggagccagagctgaagccagtttgaatcctgca
aaaaaggcctcttgtgaattttctgaggagataacaaatattgaacatcgtcaacccagt
aataaagatttgaccaccactgagaagcatgcaactgaaaagcatccagaaaagtatcag
ggtgaagcggcatctgggtacgagagtgaaacaagcctctctgaagactgttcaggggtg
tcctctcagagtgatattttaaccactcagcagagggataccatgcaagacaacctgatc
aagctccagcaggaaatggccgaactggaagccgtgttagagcagcacgagagccagcct
tctaacagctcccctgccctcataacagattcttatgcccctgaggacctgttcaatccg
gaacaaaacacatcagagaaagcagtattaacttcagagaaaagtagtgactgccttata
agccagaatcccgaaagcctctctgctgacaaatttcaagtatctctggatagttccacc
agtaaaactaaagaaccgggaatgagaaggtcttctccttctcaatcacggctgttagat
actaggcagtgtgtgcacagccactcaagcagtcttcagagcacaaactgcctgtctcag
aaggagctaattaaggctgtcgatggggaggagctacaactgactaagtcagagccccga
gatttcatggagcagtcttatatgccaagacaagatctggagggaaccccttacttcgaa
tctggaatcagcctcttctctgatgaccctgagtctgatctctctgtggacagagcccca
gaaccggttcatgttagcagcatgccaacttcaacctctgccttgaaattaccccaattt
caagttgaagaatcagccaagagtacagctgctgttcatattactaatactgctgggtat
aataagagggaagacattgagggcaaggagaagccagaaacgatgtcttcaacaaaaaga
gtcaacaaaagaatatctatggtggcatcaggcttgactccaaaagaattggtgcttgtg
cagaagtttgccagaagacaccaaatcaccttaactaatgtaatttctgaagagactact
catgtcattatgaaaacagatgctgagtttgtgtgtgaacggacactgaaatattttctg
ggtattgcaggaggaaaatgggtagttagctatttctgggtgacccagtccattaaagaa
agaaagatgctagatgagcatgattttgaagtcagaggagatgttgtcaatggaagaaac
caccagggtccgaagcgagcaagagaatcccgggacagaaagatcttcgggggcctagaa
atctgttgctatgggccctttaccaacatgcccacagatcaactagagtggatggtgcgc
ctctgtggggcttctgtggtgaagaggccttcgttattcactctcagcaaggctactcac
ccagttgtggtcgtgcaaccggatgcctggacagaggacagtggcttccatgcgattggg
cagatgtgtgaggcacctgtggtgacccgagagtgggtattggacagtgtagccctctac
cagtgccaggagctggacacctacctgatcccccagattcccagagctactgctgacctc
agccagccatgtgtgtag

DBGET integrated database retrieval system