KEGG   Panthera tigris altaica (Amur tiger): 102966574
Entry
102966574         CDS       T02988                                 

Gene name
CSF2
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04630  JAK-STAT signaling pathway
ptg04640  Hematopoietic cell lineage
ptg04650  Natural killer cell mediated cytotoxicity
ptg04657  IL-17 signaling pathway
ptg04660  T cell receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg05146  Amoebiasis
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05171  Coronavirus disease - COVID-19
ptg05202  Transcriptional misregulation in cancer
ptg05221  Acute myeloid leukemia
ptg05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102966574 (CSF2)
   04668 TNF signaling pathway
    102966574 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102966574 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102966574 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    102966574 (CSF2)
   04660 T cell receptor signaling pathway
    102966574 (CSF2)
   04657 IL-17 signaling pathway
    102966574 (CSF2)
   04664 Fc epsilon RI signaling pathway
    102966574 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102966574 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    102966574 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    102966574 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102966574 (CSF2)
   05171 Coronavirus disease - COVID-19
    102966574 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102966574 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    102966574 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ptg03019]
    102966574 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102966574 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102966574 (CSF2)
Messenger RNA biogenesis [BR:ptg03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     102966574 (CSF2)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  CSF and other factors
   102966574 (CSF2)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Cytokines
   102966574 (CSF2)
SSDB
Motif
Pfam: GM_CSF DUF1722
Other DBs
NCBI-GeneID: 102966574
NCBI-ProteinID: XP_007087839
LinkDB
Position
Un
AA seq 142 aa
MWLQNLLFLGTVVCSISAPTSSPSSVTRPWQHVDAIKEALSLLNNSSEITAVMNEAVEVV
SEMFDPEEPKCLQTHLKLYEQGLRGSLISLKQTLRMMANHYKQHCPLTPEMPCETQTITF
KNFKENLKEFLSNIPFECWKPV
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtggctgcagaacctgcttttcctgggcactgtggtctgcagcatctctgcacccacc
agttcacccagctctgtcactcggccctggcaacacgtggatgccatcaaggaggccctg
agccttctgaacaacagtagtgaaataactgctgtgatgaatgaagcagtagaagtcgtc
tctgaaatgtttgaccctgaggagccgaaatgcctacagactcacctaaagctgtacgag
cagggcctacggggcagcctcatcagcctcaagcagactctgagaatgatggccaaccat
tacaagcagcactgcccccttactccggaaatgccctgtgaaacccagactatcaccttc
aaaaatttcaaagagaatctgaaggagtttctgtctaacatcccctttgagtgctggaaa
ccagtctag

DBGET integrated database retrieval system