KEGG   Panthera tigris altaica (Amur tiger): 102966580Help
Entry
102966580         CDS       T02988                                 

Gene name
IL2RG
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04144  Endocytosis
ptg04151  PI3K-Akt signaling pathway
ptg04630  Jak-STAT signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg05162  Measles
ptg05166  Human T-cell leukemia virus 1 infection
ptg05200  Pathways in cancer
ptg05321  Inflammatory bowel disease (IBD)
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    102966580 (IL2RG)
   04151 PI3K-Akt signaling pathway
    102966580 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102966580 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102966580 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102966580 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102966580 (IL2RG)
   04659 Th17 cell differentiation
    102966580 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102966580 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    102966580 (IL2RG)
   05340 Primary immunodeficiency
    102966580 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102966580 (IL2RG)
   05162 Measles
    102966580 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102966580 (IL2RG)
   04090 CD molecules [BR:ptg04090]
    102966580 (IL2RG)
Cytokine receptors [BR:ptg04050]
 Interleukin receptor families
  IL2 receptor family
   102966580 (IL2RG)
CD molecules [BR:ptg04090]
 Proteins
  102966580 (IL2RG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 102966580
NCBI-ProteinID: XP_007089187
LinkDB All DBs
Position
Un
AA seq 369 aa AA seqDB search
MLKPPLPLRSLLFLQLPLLGVGLNSTGPKPNGNEDITADFFLTATPPEALSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPHPTNLTLHYWYKNSNDDRVQECGHYLFSGEITSGCWLQKE
EIHLYETFVVQLQDPREPRRQSTQRLKLQNLVIPWAPENLTLRNLSETQLELTWSNRHLD
HCLEHLVQYRSDWDHSWTEQSVDHRHSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEW
SRPIHWGSNTSKENPLLFAMEAVLIPLGSVGLIISLICVYCWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQPSPYWAP
PCYTLKPEP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagccaccattgccactcagatccctcttattcctgcagctgcctctgctgggg
gtggggctgaactcgacaggccccaagcccaatgggaatgaagacatcacagctgatttc
ttcctgaccgctacaccccctgaggccctcagtgtttccactctgcccctcccagaggtc
cagtgttttgtgttcaatgttgagtacatgaattgcacttggaacagcagctctgagccc
catcccaccaacctgactctgcactattggtacaagaactccaatgatgatagagtccag
gagtgtggccactatctattttctggagagatcacttctggctgctggctgcaaaaagaa
gagatacatctctatgaaacatttgttgtccagctccaggacccacgggaacccaggagg
cagtccacacagaggctgaaattgcagaatctggtgatcccctgggctccggagaaccta
acgcttcgcaacctgagtgaaacccagctagaactgacctggagtaacagacacttggac
cactgtctggagcaccttgtgcagtaccggagtgactgggaccacagctggacagaacaa
tcagtggaccacagacatagcttctctctgcctagcgtggatgggcagaaattctacacg
ttccgtgtccggagccgctataacccactctgtggaagcgctcagcgttggagtgaatgg
agccgcccgatccactggggcagcaatacttcaaaggagaatcctttgttgtttgcaatg
gaagctgtgcttatcccccttggctccgtgggattgattattagccttatctgtgtgtac
tgctggctggaacggacgatgccccggattcctaccctcaagaacctagaggatctggtt
actgaatatcacgggaacttttcggcctggagtggagtatctaagggactggcggagagt
ctgcagccagactacagtgaatggctctgccacgtcagtgagattccgccaaaaggaggg
gctccaggggaggggcctgggggctccccctgcagccagcccagcccctactgggctccc
ccgtgttacaccctgaaaccggagccctga

DBGET integrated database retrieval system