KEGG   Panthera tigris altaica (Amur tiger): 102966666
Entry
102966666         CDS       T02988                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04014  Ras signaling pathway
ptg04390  Hippo signaling pathway
ptg04392  Hippo signaling pathway - multiple species
ptg05200  Pathways in cancer
ptg05206  MicroRNAs in cancer
ptg05219  Bladder cancer
ptg05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102966666 (RASSF1)
   04390 Hippo signaling pathway
    102966666 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102966666 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102966666 (RASSF1)
   05206 MicroRNAs in cancer
    102966666 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102966666 (RASSF1)
   05223 Non-small cell lung cancer
    102966666 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH DUF5111
Other DBs
NCBI-GeneID: 102966666
NCBI-ProteinID: XP_007088635
LinkDB
Position
Un
AA seq 272 aa
MGEADAGTPSFEMTWSSTASSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAETEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQAA
QRGPGRGTAVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggcgaggcggatgcggggacgccttctttcgagatgacctggagcagcacggcaagc
agtggctactgcagccaggaggattcggactcggagcttgagcagtacttcacggcgcgt
acctcgctggcacgcaggccgcgtcgggaccaggacgagcctgtggagtgggagacacct
gacctttctcaggctgaaactgagcagaagatcaaggagtacaatagccagatcaacagc
aacctcttcatgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactg
aagctggtgcgccctgtctcggtgccctccagcaagaagccaccctccttgcaggctgcc
cagcggggcccaggacggggcacagctgtgaggcgccgcacctccttctacttgcccaaa
gatgccgtcaagcacctgcatgtgttgtcacgcacacgggcacgcgaggtcattgaggcc
ctactgcgcaagttcttagtggtggatgacccccgcaagtttgcactctttgagcgggct
gaacgccatggccaagtgtacctccggaagctatcagatgatgagcaacccctgcggctg
cggctccttgcagggcccagcgagaaggccctaagctttgtcctcaaagagaatgactct
ggggaggtaaattgggatgcctttagcatgcctgagctacacaacttcttgcgcatcctg
cagcgggaggaagaggaacacctccgccaaatcctgcaaaagtactcctattgccgtcag
aagatccaggaggccctgcacgcctgccccctggggtga

DBGET integrated database retrieval system