KEGG   Panthera tigris altaica (Amur tiger): 102966812
Entry
102966812         CDS       T02988                                 

Gene name
MAP2K4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04012  ErbB signaling pathway
ptg04620  Toll-like receptor signaling pathway
ptg04664  Fc epsilon RI signaling pathway
ptg04668  TNF signaling pathway
ptg04912  GnRH signaling pathway
ptg04926  Relaxin signaling pathway
ptg04935  Growth hormone synthesis, secretion and action
ptg05132  Salmonella infection
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05161  Hepatitis B
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05169  Epstein-Barr virus infection
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102966812 (MAP2K4)
   04012 ErbB signaling pathway
    102966812 (MAP2K4)
   04668 TNF signaling pathway
    102966812 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102966812 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    102966812 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102966812 (MAP2K4)
   04926 Relaxin signaling pathway
    102966812 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    102966812 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102966812 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102966812 (MAP2K4)
   05135 Yersinia infection
    102966812 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102966812 (MAP2K4)
   05161 Hepatitis B
    102966812 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102966812 (MAP2K4)
   05169 Epstein-Barr virus infection
    102966812 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102966812 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102966812 (MAP2K4)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     102966812 (MAP2K4)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: STE group
  STE7 family
   102966812 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 102966812
NCBI-ProteinID: XP_015399829
LinkDB
Position
Un
AA seq 368 aa
QGSLPSPSARAVITKYYSLGGSNNRSLLLAVLEAGKIKVPTRERLRTHSIESSGKLKISP
EQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDV
VMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLA
TVKALNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMA
PERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNS
EEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPAT
PSSPMYVD
NT seq 1107 nt   +upstreamnt  +downstreamnt
caaggaagtttgccttctccatccgctcgggccgtcataacaaaatactacagcttgggt
ggctccaacaacagaagtctattgctggcagttctggaggccgggaagatcaaggtgccg
accagagagaggctgagaacacacagcatcgaatcgtcgggaaaactgaagatctctcct
gagcagcactgggatttcaccgcggaggacttgaaggaccttggagaaatcggacgagga
gcttacggttccgtcaacaaaatggtccacaaaccaagtgggcagataatggcagttaaa
agaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggatttggatgta
gtaatgcgcagtagtgactgcccgtacattgttcagttttatggtgcactcttcagagag
ggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttttacaaatat
gtatatagtgtattagatgatgttattccagaagaaattttaggcaaaatcactttagca
actgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcacagagatatcaaa
ccttccaatattcttctggacaggagtgggaatattaagctctgtgactttggcatcagt
ggacagctggtggactccattgccaagacaagagatgccgggtgtaggccgtacatggca
cctgaaagaatagacccaagtgcatctcgacaaggatacgatgtccgctctgatgtctgg
agtttggggatcacattgtacgagttagccacaggccgatttccttacccaaagtggaat
agtgtattcgatcaactaacacaagtcgtgaaaggagaccctccacagctgagtaactcg
gaggaaagggagttctcccccagtttcatcaactttgtcaacttgtgccttacgaaggat
gaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttgatgtatgaa
gaacgtaccgtagaggtcgcatgctacgtttgtaaaatcctggatcaaatgccagccact
cccagctcccccatgtacgtcgactga

DBGET integrated database retrieval system