KEGG   Panthera tigris altaica (Amur tiger): 102966922Help
Entry
102966922         CDS       T02988                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg00983  Drug metabolism - other enzymes
ptg01524  Platinum drug resistance
ptg05200  Pathways in cancer
ptg05204  Chemical carcinogenesis
ptg05225  Hepatocellular carcinoma
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102966922 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102966922 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102966922 (GSTO1)
   00983 Drug metabolism - other enzymes
    102966922 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102966922 (GSTO1)
   05204 Chemical carcinogenesis
    102966922 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    102966922 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    102966922 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    102966922 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102966922 (GSTO1)
Enzymes [BR:ptg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102966922 (GSTO1)
Transporters [BR:ptg02000]
 Other Transporters
  Pores ion channels [TC:1]
   102966922 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_C GST_N_2 GST_C_2 GST_N GST_C_5
Motif
Other DBs
NCBI-GeneID: 102966922
NCBI-ProteinID: XP_007080372
LinkDB All DBs
Position
Un
AA seq 349 aa AA seqDB search
MSLRVSSFFCGSGRGYLSWPASTLGHDQQLRCFSASSAKPGRPGLGGRVGWVSGCDFPAG
SWPQGRRVPACRGWEGDSGRLAPAFIKRLGPRGARRAQPPPSWRPPPAGTSERRREGSKD
RGRGDVLPEPPAHPGSRAGPALRRDVRRVSQEPSEGHEIININLKNKPEWFFTKNPFGLV
PVLENSQGQLIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELFSKVPPLVTSFIR
RQNNEDGSGLKEELRKEFSKLEEVLTNKKTTFFGGNSLSMIDYLIWPWFERLEVLELNEC
VDHTPKLKLWMAAMREDPAVSSLLIEAKAFRGFLDLYLQNSPEACDYGL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgagggtgtccagcttcttctgtggctctggacgtgggtacctctcttggcca
gcgagtacactcgggcacgaccagcagctgcggtgttttagcgctagctctgcaaaaccg
ggaaggccaggcctaggtgggcgcgttgggtgggtctccggctgcgatttccctgcaggc
tcttggccgcaggggcggcgcgttcccgcttgcagagggtgggaaggggattctggacgc
ctcgcgcccgctttcattaagcgcctggggccacgcggggcccggagagcacagcccccg
cccagctggcggccgcccccggcaggcacttctgagaggagaagagaagggagcaaggac
cgagggaggggcgacgtacttcctgaaccgcctgcacaccctgggtcgcgagctgggcct
gccctgcgccgcgatgtccggagggtcagccaggagcctagcgaagggcatgaaatcatc
aacatcaacctgaaaaataaacctgagtggttctttacgaagaatccctttggtctggtg
ccagttctggaaaacagtcagggtcaactgatctatgaatctgccattacttgtgagtac
ctggatgaagcatatccagggaagaagctgttgcccgatgacccctatgagaaagcttgc
caaaagatggtctttgagttattttctaaggttccccctttggtaacaagcttcattaga
agacaaaataacgaagacggctctggcctaaaagaagaattgcgtaaagaattcagcaag
ttagaggaggttctgaccaataagaagacaaccttctttggtggcaattctctttctatg
attgattacctcatctggccctggtttgaacggctcgaagttctggagttaaatgagtgt
gtagatcacactccaaaacttaagctctggatggcagccatgagggaagatcctgcagtg
tcctccctcctcattgaggcgaaggcctttcgaggtttcttagatctctacttgcagaac
agccctgaggcctgtgattatgggctctga

DBGET integrated database retrieval system