KEGG   Panthera tigris altaica (Amur tiger): 102966939
Entry
102966939         CDS       T02988                                 

Definition
(RefSeq) cytochrome P450 1A2
  KO
K07409  cytochrome P450 family 1 subfamily A2 [EC:1.14.14.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00140  Steroid hormone biosynthesis
ptg00232  Caffeine metabolism
ptg00380  Tryptophan metabolism
ptg00591  Linoleic acid metabolism
ptg00830  Retinol metabolism
ptg00980  Metabolism of xenobiotics by cytochrome P450
ptg00982  Drug metabolism - cytochrome P450
ptg01100  Metabolic pathways
ptg05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    102966939
   00591 Linoleic acid metabolism
    102966939
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    102966939
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102966939
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    102966939
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102966939
   00982 Drug metabolism - cytochrome P450
    102966939
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    102966939
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     102966939
Cytochrome P450 [BR:ptg00199]
 Cytochrome P450, animal type
  CYP1 family
   102966939
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102966939
NCBI-ProteinID: XP_007084659
LinkDB
Position
Un
AA seq 512 aa
MAISPTATELLLASFAFCLVFWVVRAWQPRVPKGLKSPPGPWGWPLLGHVLTLGKNPHLV
LARLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVQQGDDFKGRPDLYSFRLVTDGHSIA
FSPDSGPVWAACKRLAQSALNTFSIASDPASASSCHLEDHVSKEAEALISRLQEQMAEVG
SFDPHSQVVLSVANVIGAMCFGQHFPQDSEEKLSLIHSSNTFVENASSGNPVDFFPIFQY
IPTPGLQRFKAFNQKLVQFLQKIIQEHYQDFDENNIQDITGALLKHCKKGSRANGGRIPH
EKIVSLINDIFGAGFDTVTTAISWSLMYLVTNPEKQRKIQEELDTVVGRARRPRLSDRLQ
LPYLEASILEIFRHSSFIPFTVPHSTTRDTTLNGFYIPEKHLVFINQWQVNHDQKVWGDP
FEFRPERFLTADGTAINKILSEKVMIFGLGKRRCIGEVLAKWEVFLFLAILLQQLEFSVP
AGVKVDLTPIYGLTMKHVRCEHVQARPRFSIK
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggcaatatccccaacggccacagagcttctcctggcctcctttgccttctgcctggtg
ttctgggtggtcagggcctggcagcctcgggttcccaaaggcctgaagagtccaccaggg
ccctggggctggcctctgctcgggcacgtgctgaccttggggaagaacccacatctggtg
ctggcaaggctgagccagcgttacggggacgtgctgcaaatccgcatcggctccacaccc
gtgctggtgctcagtggcctggacaccatccggcaggccctggtgcagcagggtgatgac
ttcaagggccggcccgacctctacagcttcaggctggtcactgatggccacagcatagcc
ttcagcccagactctggaccggtgtgggccgcctgcaagcgcctggcccagagcgctctc
aacaccttctccattgcctcagacccggcttccgcatcctcctgccatctggaagaccat
gtgagcaaggaggccgaggccctcatcagcaggttgcaggaacagatggcagaggtcggg
agcttcgatccccatagccaagtggtgctgtcagtggccaatgtcattggtgccatgtgc
tttgggcagcactttcctcaggacagtgaggaaaagctcagcctcatacacagcagcaat
acattcgtggagaatgcgtcctctgggaaccctgtggacttcttccccatctttcaatat
atccccacccctggcctgcagagattcaaggccttcaaccagaagttggtacagttcctg
cagaaaattatccaggagcactaccaggactttgacgagaacaacatccaggacatcaca
ggcgccctgttgaagcactgtaagaagggctccagagctaatggtggccgcatccctcac
gagaagattgtcagccttatcaacgacatttttggggccggatttgacactgtcacaaca
gccatctcctggagccttatgtaccttgtgacaaatcctgagaaacagagaaagatccag
gaggagctggacacagtggttggcagggcacggcggccccggttgtctgacagactccag
ctgccctacctggaggcctccatcttggagatcttccgacactcctccttcatccccttc
actgtcccccacagcacaacaagggacacgacactgaatggcttctacatcccagagaaa
caccttgtcttcataaaccagtggcaggtcaatcatgaccaaaaggtgtggggagatcca
tttgagttccggccagagcgattcctcactgctgatggcactgccatcaacaagatctta
agcgagaaggtgatgatctttggcctgggcaagcgccggtgtataggggaggtcctggcc
aagtgggaggtcttcctcttcctagccatcttgctgcagcagctggagttcagcgtgcca
gcgggtgtgaaagtagacctaactcccatctatggactgaccatgaagcacgtccgctgt
gagcacgtccaggcccggccacgtttctccatcaagtga

DBGET integrated database retrieval system