KEGG   Panthera tigris altaica (Amur tiger): 102967087
Entry
102967087         CDS       T02988                                 

Gene name
DPYS
Definition
(RefSeq) dihydropyrimidinase
  KO
K01464  dihydropyrimidinase [EC:3.5.2.2]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00240  Pyrimidine metabolism
ptg00410  beta-Alanine metabolism
ptg00770  Pantothenate and CoA biosynthesis
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    102967087 (DPYS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102967087 (DPYS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    102967087 (DPYS)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102967087 (DPYS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102967087 (DPYS)
Enzymes [BR:ptg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.2  dihydropyrimidinase
     102967087 (DPYS)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102967087 (DPYS)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 102967087
NCBI-ProteinID: XP_015390202
LinkDB
Position
Un
AA seq 423 aa
MIIDFAIPQKGGSLIKAFETWRSWADPKVCCDYSLHVAVTWWSDQVKEEMKILTQDKGVN
SFKMFMAYKDLYMVRDEELYAAFSQCKEIGAIAQVHAENGDLIAEGAKKMLALGITGPEG
HELCRPEAVEAEATLRAITIASAVNCPLYIVHVMSKSAAKVIADARRDGKVVYGEPIAAS
LGTDGTHYWHKDWHHAAHHVMGPPLRPDPSTPDFLMNLLANGDLTTTGTDHCTFNTCQKA
LGKDDFTKIPNGVNGVEDRMSVIWEKGVHSGKMDENRFVAVTSTNAAKVFNLYPRKGRIA
VGSDADIVIWDPKATRTISARTHHQAVNFNIFEGMVCHGVPLVTISRGKVVYEAGVLSVT
AGDGKFIPRKPFAEYIYKRIKQRDQTCTPTPVEREPYKGEVVTLKTRETKEDAAAGTRKQ
AHP
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgatcattgattttgccattcctcagaagggcggttccctcatcaaggccttcgagacc
tggcgaagctgggctgatcccaaagtctgctgtgactacagtcttcacgtggcagtgaca
tggtggagtgaccaggttaaagaagaaatgaaaatccttacccaagacaaaggtgtgaac
tctttcaagatgtttatggcctataaagacctgtacatggtgagggacgaggagctgtat
gccgccttctctcagtgcaaggagatcggagcaattgctcaagtccacgcagaaaacgga
gacctgattgcggagggagcaaagaagatgctggcattggggataacaggccctgagggc
catgagctgtgccgcccggaagcagtggaggcagaggccacactgagagccatcaccata
gccagcgctgtgaactgccctctctacatcgtgcacgtgatgagcaaatctgcagcaaag
gtgatagccgatgcgaggagagacgggaaagtggtctatggagaacccatagcggcaagt
ctcggcacagatggcactcactattggcataaagactggcaccatgcagcccaccatgtt
atgggcccacccctgcgaccagacccatcaacgcctgacttcctcatgaatctattggct
aatggtgatctaaccacaacaggaactgaccactgcactttcaacacctgccagaaagct
cttgggaaggatgatttcacgaagattcccaatggggtgaatggtgttgaggaccggatg
tcagtaatatgggaaaaaggcgtgcatagtggcaaaatggacgaaaatcgatttgtggca
gttaccagcacaaatgcagctaaagtctttaatctctatccaagaaaaggaagaatcgcg
gtgggatcagatgcagacattgtgatttgggacccaaaagccacaaggactatttcggca
agaactcatcatcaggctgttaacttcaatatcttcgagggcatggtttgccacggggtg
ccccttgtgaccatttccagaggcaaagtggtgtatgaagctggagttcttagtgtcaca
gcaggagatggaaagtttattcctcgcaaaccatttgctgagtatatttacaaacggatc
aagcagcgagaccagacttgcacacctacccctgtggagcgtgaaccctacaagggagaa
gtcgtcacactgaaaactagagagacaaaagaagacgccgcagcagggaccaggaaacag
gcccacccctga

DBGET integrated database retrieval system