KEGG   Panthera tigris altaica (Amur tiger): 102967196
Entry
102967196         CDS       T02988                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg01521  EGFR tyrosine kinase inhibitor resistance
ptg01522  Endocrine resistance
ptg04012  ErbB signaling pathway
ptg04066  HIF-1 signaling pathway
ptg04072  Phospholipase D signaling pathway
ptg04136  Autophagy - other
ptg04140  Autophagy - animal
ptg04150  mTOR signaling pathway
ptg04151  PI3K-Akt signaling pathway
ptg04152  AMPK signaling pathway
ptg04211  Longevity regulating pathway
ptg04213  Longevity regulating pathway - multiple species
ptg04218  Cellular senescence
ptg04371  Apelin signaling pathway
ptg04630  JAK-STAT signaling pathway
ptg04659  Th17 cell differentiation
ptg04714  Thermogenesis
ptg04910  Insulin signaling pathway
ptg04919  Thyroid hormone signaling pathway
ptg04920  Adipocytokine signaling pathway
ptg04930  Type II diabetes mellitus
ptg04931  Insulin resistance
ptg04935  Growth hormone synthesis, secretion and action
ptg05010  Alzheimer disease
ptg05014  Amyotrophic lateral sclerosis
ptg05016  Huntington disease
ptg05017  Spinocerebellar ataxia
ptg05022  Pathways of neurodegeneration - multiple diseases
ptg05163  Human cytomegalovirus infection
ptg05165  Human papillomavirus infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05200  Pathways in cancer
ptg05205  Proteoglycans in cancer
ptg05206  MicroRNAs in cancer
ptg05210  Colorectal cancer
ptg05212  Pancreatic cancer
ptg05214  Glioma
ptg05215  Prostate cancer
ptg05221  Acute myeloid leukemia
ptg05224  Breast cancer
ptg05225  Hepatocellular carcinoma
ptg05226  Gastric cancer
ptg05230  Central carbon metabolism in cancer
ptg05231  Choline metabolism in cancer
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102967196 (MTOR)
   04371 Apelin signaling pathway
    102967196 (MTOR)
   04630 JAK-STAT signaling pathway
    102967196 (MTOR)
   04066 HIF-1 signaling pathway
    102967196 (MTOR)
   04072 Phospholipase D signaling pathway
    102967196 (MTOR)
   04151 PI3K-Akt signaling pathway
    102967196 (MTOR)
   04152 AMPK signaling pathway
    102967196 (MTOR)
   04150 mTOR signaling pathway
    102967196 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102967196 (MTOR)
   04136 Autophagy - other
    102967196 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    102967196 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102967196 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102967196 (MTOR)
   04920 Adipocytokine signaling pathway
    102967196 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    102967196 (MTOR)
   04919 Thyroid hormone signaling pathway
    102967196 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    102967196 (MTOR)
   04213 Longevity regulating pathway - multiple species
    102967196 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    102967196 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102967196 (MTOR)
   05206 MicroRNAs in cancer
    102967196 (MTOR)
   05205 Proteoglycans in cancer
    102967196 (MTOR)
   05230 Central carbon metabolism in cancer
    102967196 (MTOR)
   05231 Choline metabolism in cancer
    102967196 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102967196 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102967196 (MTOR)
   05212 Pancreatic cancer
    102967196 (MTOR)
   05225 Hepatocellular carcinoma
    102967196 (MTOR)
   05226 Gastric cancer
    102967196 (MTOR)
   05214 Glioma
    102967196 (MTOR)
   05221 Acute myeloid leukemia
    102967196 (MTOR)
   05215 Prostate cancer
    102967196 (MTOR)
   05224 Breast cancer
    102967196 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102967196 (MTOR)
   05014 Amyotrophic lateral sclerosis
    102967196 (MTOR)
   05016 Huntington disease
    102967196 (MTOR)
   05017 Spinocerebellar ataxia
    102967196 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    102967196 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102967196 (MTOR)
   04931 Insulin resistance
    102967196 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102967196 (MTOR)
   05168 Herpes simplex virus 1 infection
    102967196 (MTOR)
   05163 Human cytomegalovirus infection
    102967196 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102967196 (MTOR)
   05165 Human papillomavirus infection
    102967196 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102967196 (MTOR)
   01522 Endocrine resistance
    102967196 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102967196 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptg04131]
    102967196 (MTOR)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102967196 (MTOR)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102967196 (MTOR)
Membrane trafficking [BR:ptg04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    102967196 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase Coatomer_E HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 102967196
NCBI-ProteinID: XP_007078433
LinkDB
Position
Un
AA seq 2553 aa
MLGTGPATATTATTTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAGQPPQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTALPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYXXXXXXXXXXLNFLKTEQNQGTRREAIRVLGLLGALDPY
KHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMR
IFRDQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLG
MLVSFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPH
MLRVFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALE
TVDRLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNK
VLVRHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKK
LHVSTINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDL
FNAAFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDD
NGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAM
KHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQC
CEKWTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLF
SLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQ
IWWERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLL
GVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIASEDQ
QHKQELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRGWYKAWHAWAVMN
FEAVLHYKHQNQARDEKKKLRHASGANVTSTTTAATTAATPPATATSTEGSNSQSEAEST
ENSPTPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHW
PDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPL
TVASKSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASR
LYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKD
LTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPHQPIIRIQSI
APSLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSL
RKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYD
HLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGL
GDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNY
RITCHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVE
ILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHD
ETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7662 nt   +upstreamnt  +downstreamnt
atgctgggaaccggacctgccaccgccaccacagccaccaccacgtccagcaacgtgagc
gtcctgcagcagtttgccagcggcctgaagagccggaatgaggagaccagggccaaagct
gccaaggagctccagcactatgtcaccatggagcttcgagagatgagtcaagaggagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcggatgcc
aatgaaaggaaaggtggcatcttggccatagccagcctcataggagtggaaggcgggaat
gccacccgtatcggcagatttgctaactatcttcggaacctcctcccctctaatgaccca
gttgtcatggagatggcatccaaggccattggccgccttgccatggcaggcgacactttt
acagctgagtatgtggagttcgaggtgaagcgagccttggagtggctgggcgctgaccgc
aacgagggccggagacacgcagccgttctggttctccgcgagctggctatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggccatccgggagggagctgtggccgcccttcgtgcctgtttgattcttacc
acccagcgtgagccaaaggagatgcagaagcctcagtggtacaggcacacgtttgaagaa
gcagagaaagggtttgatgagacgttggccaaggagaagggcatgaatcgggatgatcgc
atccatggagccttgctgatcctcaacgagttggtccgaatcagcagcatggagggagag
cgcctgagagaagaaatggaagaaatcacgcagcagcagctggtccatgacaagtactgc
aaagacctcatgggcttcgggacgaaacctcgccacatcacccccttcaccagcttccag
gctggccagcccccgcagtccaacgccttggtgggactgctggggtacagctctcaccaa
ggcctcatgggtttcggggcttcccccagcccagcgaagtccacgctggtggagagccgg
tgttgcagagacctgatggaggagaaattcgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcatttcgaccttctgccttcacagatacccagtacctccaagataccatgaaccacgtc
ttgagctgtgtcaagaaggagaaggaacggacggcagccttccaagccctggggctcctt
tctgtggctgtgagatctgagttcaaggtctatttgcctcgtgtgctggacatcatccga
gcagccctacccccaaaggactttgcccataagagacagaaggcaatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgggcaatggggccaggcatccagcaggat
atcaaggagctgctggagcccatgctggcagtgggactgagccctgccctcactgctgtg
ctgtacgacctgagccgtcagattccacagctgaagaaggacatccaggatgggctactg
aagatgctgtccctggtccttatgcacaaacccctccggcacccgggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacagccctccctgaggccagcgacgtgggc
agcattactcttgccctgcgaactctcggcagctttgagtttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcatttcctaaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgctcacgccctccgtccacctcatcagcggccac
gcgcacgtcgttagccagactgcggtgcaagtggtggcagacgtgctcagcaaactgctc
gtggtcgggatcacagatcctgaccccgacatccgctactgcgtcttggcatctctggat
gagcgctttgatgcacacctggcccaggcagagaacttgcaggccctgtttgtggccctg
aacgaccaggtgtttgagatccgggagctggccatctgcacggtgggccggctcagtagc
atgaacccggccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacagaa
ctggagcacagcggcattgggagaatcaaagaacagagtgcccgcatgctgggccacttg
gtctccaatgccccccggctcatccgcccctacatggagcccattctgaaggctttaata
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggcc
acaataggagagttggctcaggtcagtggcctagaaatgaggaaatgggttgatgaactc
tttattatcatcatggacatgctccaggactcctccctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtggtggagccctacaggaag
tacnnnnnnnnnnnnnnnnnnnnnnnnnnnnngctgaattttctgaagactgagcagaac
cagggtacacggagagaggctatccgtgtgttagggcttttgggggccctggatccctac
aagcacaaagtgaacattggcatgattgaccagtcccgcgacgcttctgctgttagcctg
tcagaatccaagtcaagtcaggattcctctgactacagcaccagcgagatgctggtcaac
atgggcaacctgcccctggacgagttctaccccgccgtgtccatggtggcgctgatgcgg
atcttccgggaccagtccctctcgcaccatcacaccatggtagtccaggccatcaccttc
atcttcaagtccctgggcctcaagtgtgtgcagttcctgccccaggtcatgcccacgttc
ctcaatgtcattcgcgtctgtgacggggccatccgggagtttctgttccagcagctgggg
atgctggtgtcctttgtgaagagccacatcagaccttacatggatgaaatagtcaccctc
atgagagaattctgggtcatgaacacctcgatccagagcacgatcattcttctcattgag
caaatcgtggtagctcttgggggcgaatttaagctctatctgcctcagctgatcccacac
atgctacgtgtcttcatgcatgacaacagcccaggccgcattgtctccatcaagctgctg
gctgccatccagctgttcggcgccaacctggacgactatttgcacttgctgttgcctcct
atcgtgaagctgtttgatgcccctgaagtccccctgccgtcccgcaaggcagcgttagag
acggtagaccgcctcacggagtccttggacttcactgactacgcctcccggatcattcac
ccgatcgttcgaaccctggaccagagcccggaactgcgtcccacggccatggacacgttg
tcttcgcttgtctttcagctggggaagaagtaccaaattttcattccaatggtgaataaa
gtcctggtacgacaccgaatcaaccatcagcgctatgacgtcctcatctgcagaatcgtc
aagggatacacccttgctgatgaggaagaggaccctttgatttaccagcatcgaatgctg
aggagtggccaaggggatgcgttggccagtgggccggtagaaacaggacccatgaagaaa
ctgcatgtcagcaccatcaaccttcaaaaggcctggggagctgccagaagggtctccaaa
gatgactggctagaatggctgaggcggctgagtctggagctcctgaaggactcgtcttca
ccttccctgcgctcgtgctgggccctggctcaggcctacaacccgatggccagggatctt
ttcaacgccgcgtttgtgtcctgctggtctgaactgaacgaagaccagcaggatgaactc
atcaggagcatcgagctggccctcacctcgcaggacatcgccgaagtcacgcaaactctc
ttaaacttggctgaattcatggaacacagtgacaagggccccctgccactgagagacgac
aacggcatcgtcctgctgggcgagagggccgccaagtgccgagcatatgccaaagcacta
cactacaaagagctggagttccagaaaggtcccacccccgccatcctagagtctctcatc
agcattaataataagctacaacagccagaggcagctgccggggtattagaatatgccatg
aaacacttcggagagctggagatccaggccacctggtacgagaagctgcacgagtgggaa
gatgcgctcgtggcctacgacaagaagatggacaccaacaaggacgacccagagctcatg
ctgggtcgcatgcgctgcctcgaggccttgggggaatgggggcagctccaccagcagtgc
tgtgagaagtggaccctggttaacgatgagacccaagccaagatggcccggatggccgct
gcagctgcctggggcttaggtcagtgggacagcatggaggaatatacctgtatgatccct
cgggacacccacgatggggcattttatagagccgtgctggcactacatcaggacctcttc
tccttggcgcaacagtgtatcgacaaagccagggacctgctggatgcagagctaactgct
atggcaggagagagctacagtcgggcatatggggccatggtttcttgccacatgctctcc
gagctggaggaggttatccagtacaagctcgtccccgagcgacgggagatcatccgccag
atctggtgggagagactgcagggctgccagcgcatcgtggaggactggcagaaaatcctg
atggtgcgctcgctcgtggtcagcccccacgaggacatgaggacctggctcaagtatgcc
agcctgtgtggcaagagtggcaggctggctcttgctcataagaccttggtgttgctcctg
ggagttgatccgtctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacc
tacgcctacatgaaaaacatgtggaagagtgctcgcaagatcgatgccttccagcacatg
cagcacttcgtgcagaccatgcagcagcaagcccagcacgccatcgccagcgaggaccag
cagcacaagcaggagctgcacaagctcatggccaggtgtttcctgaaactcggggagtgg
cagctgaacctgcagggcatcaatgagagcaccatccccaaagtgctgcagtactacagc
gccgccacggagcacgaccgcggctggtacaaggcctggcacgcgtgggcagtgatgaac
ttcgaagccgtgctgcactacaaacatcagaaccaagcccgcgacgagaagaagaagctg
cgtcacgccagcggggccaacgtcaccagcacgaccactgccgccaccacagcggccacc
ccccccgccacggccaccagcaccgagggcagcaacagccagagtgaggccgagagcacc
gagaacagccccaccccgtcccctctgcagaagaaggtcactgaggatttgtccaaaacc
ctcttgatgtacaccgtccctgccgtccagggcttcttccgttctatctccttgtcgcga
ggcaacaacctccaggacacactgagagtcctcaccctgtggtttgattacggtcactgg
ccggacgtaaacgaagccttggtggagggggtgaaggcgatccagattgacacgtggtta
caggtcatacctcagctcattgcaagaattgatacgcccaggcccttggtgggacgcctc
atccaccagcttctcaccgacattggccggtaccacccccaggccctcatctatcccctg
accgtggcctccaagtccaccaccacggcccgccacaacgcagccaacaagattctgaag
aacatgtgtgagcacagtaacaccctggtccagcaggccatgatggtgagtgaggaactg
atccgcgtggccatcctctggcacgagatgtggcacgaaggcctggaagaagcgtctcgt
ttatactttggggagaggaacgtgaaaggcatgtttgaggtgttggagcccctgcatgct
atgatggaacggggcccccagactctgaaggaaacgtcttttaatcaggcgtatgggcga
gacttaatggaggcccaagagtggtgcaggaagtacatgaaatcgggaaatgtgaaggac
ctcactcaagcctgggacctctactatcacgtgttcagacgaatctcaaagcagctgcct
cagctcacatccttagaactgcagtatgtttcccccaaacttctgatgtgccgagacctt
gaattggccgtgccgggaacatacgacccccaccagccgatcatccgcattcagtccata
gcgccgtctctacaggtcatcacctccaagcagcggccccggaagttgaccctcatgggc
agcaacgggcatgagtttgttttcctcctgaagggccacgaggacctgcggcaggacgag
cgagtgatgcagctcttcggcctggtgaacaccctcctggccaacgaccccacgtctctt
cgcaagaacctcagcatccagagatacgctgtcatccccttatcaaccaactcgggcctc
atcggctgggtcccccactgcgacacgctgcacgccctcatccgggactacagagagaaa
aagaagatccttctcaacatcgagcatcgcatcatgttgcggatggctccggactacgac
catctgacgctgatgcagaaggtggaggtgttcgagcacgccgtcaataacacggccggg
gatgacctggccaagctgctatggctgaaaagccccagctccgaggtgtggtttgaccga
agaaccaactacacccgctctttagcggtcatgtccatggtcgggtatattttgggccta
ggagatagacacccatccaacttaatgctggaccggctgagcgggaagatcctgcacatt
gacttcggggactgctttgaggttgctatgaccagggagaaattcccagagaagattcca
tttagactaaccagaatgctgaccaatgctatggaggttactggtctggatggcaactac
agaatcacgtgccacacagtgatggaagtgcttcgggaacacaaggatagtgtcatggcc
gtgctggaagcctttgtctatgaccccttgctgaactggaggctgatggacacaaatacc
aaaggcaacaagcggtcccgaacaaggacggattcctactctgctggccagtcagtagaa
attttggacggtgtggagcttggtgaacccgcgcataagaaaacagggaccacggtgcca
gagtccattcattccttcattggagacggtttggtgaaaccagaggccctaaataagaaa
gctattcagattatcaaccgggttcgagacaagctcactggtcgggacttttctcatgac
gaaaccctggatgtccccactcaagttgagctgctgatcaagcaagcaacatcccatgaa
aacctgtgccagtgctacatcggctggtgtcctttttggtaa

DBGET integrated database retrieval system