KEGG   Panthera tigris altaica (Amur tiger): 102967219Help
Entry
102967219         CDS       T02988                                 

Gene name
TGM5
Definition
(RefSeq) transglutaminase 5
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102967219 (TGM5)
Enzymes [BR:ptg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102967219 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 102967219
NCBI-ProteinID: XP_007081787
LinkDB All DBs
Position
Un
AA seq 719 aa AA seqDB search
MEQGLEVALTDLQSSWNNVRHHTEEISSDRLLVRRGQAFNITLYFRKRGFQPGLDNIIFV
AETGPLPDLSNGTRALFSLAGHHGPSPWIASLETNGASSLEVSLCAPPTAAVGRYLLKVH
IDCFQKSVTAYQLGEFILLFNPWCPGDSVYLDSEPQRQEYVVNDYGFIYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQIDPATDCALRGSPVYISRVVCAMINSNDDNGVLNG
NWSESYLDGINPAEWTGSVAILKQWHATGCQPVRYGQCWVFAAIMCTVMRCLGIPTRVIT
NFDSGHDTDGNLIIDEYYDSTGRILENKKKDTVWNFHVWNECWMARKDLPPGYGGWQVLD
ATPQETSNGLYCCGPASVRAIKEGEVDLNYDTAFAFSMVNADCMSWLVYGGKEQKIHRDT
NTVGNFISTKSIQSDERDDVTENYKYIEGSPQERLVFMRALQKLKARRSEGPHKADSQHS
TPVPLNRDSPRSLHMPSLRPSDIVQVSLKFQLLDPPNMGQDIRFVLLALNMSLQFKDLKV
NLSAQSLLHDGSPLPPFWQDTAFITLSPEEAKTHSCRIPYSQYSQYLSTDKLIRISALGE
EKNSPEKILVDKIITLAYPGIMINVLGAAIVNQPLSIQVLFSNPLSEHVADCVLTVEGSG
LFKKQQRVLIGVLKPQHRASITLETVPFKSGQRQIQANLRSNKFKDIKGYKNVYVDLRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagggctggaggtggcccttacagacctccagagctcctggaacaatgtgcgg
caccacacagaggagatcagctctgaccgactcctggttcgccggggccaggccttcaac
atcactctgtacttcaggaagcggggcttccagccaggcctggacaatatcatctttgtg
gctgagactggacccctaccagacttgtccaatgggactcgagccctgttcagcctggca
ggtcatcatggtcccagcccatggattgcctctctggagaccaatggggccagctccctg
gaggtgagcctgtgtgcccctcccacggcagccgtgggtcggtatctcttgaaagttcat
attgactgtttccagaagtctgtcacagcctaccagcttggggagttcatcctgctcttc
aatccctggtgcccaggggattctgtctacttggacagtgagccccagaggcaggagtat
gtcgtgaatgattacggcttcatttaccaagggaacaagaattggatccgcccgtgtccc
tggaactatggacagtttgaagagaatatcatagacatctgcctggagctactagacaag
agtctgaacttccagattgatccagctacagactgtgccctgcggggaagccccgtctac
atcagcagagtggtgtgtgccatgatcaacagcaacgatgacaatggggtgcttaatgga
aactggagtgagagttatttagatggcatcaaccctgcagagtggaccggcagtgtggcc
atcctgaaacagtggcatgccacaggctgccagccagtgcgctacgggcagtgctgggtc
tttgctgccatcatgtgcacagtaatgaggtgcctggggatccccacccgtgtgatcacc
aactttgactctggccacgacacagatggaaacctgatcatagatgagtattatgacagc
acaggcaggatcttggagaataagaagaaggacactgtctggaattttcatgtgtggaat
gagtgttggatggcccgaaaggacctccctcccggatatggaggctggcaggtgctggat
gccacccctcaggagacgagcaatggcctctactgctgtggccctgcctctgtcagagcc
atcaaagagggagaggtggatctgaactatgacacagcctttgccttttccatggtcaat
gctgactgcatgtcctggcttgtctacggagggaaggagcagaaaattcaccgggacacg
aatactgttggcaattttatcagcaccaagagcattcaaagtgatgagcgagatgacgtc
acagagaactacaaatacatagaaggttccccccaggagaggctggtgtttatgagagct
cttcagaagctgaaggctagaaggtctgaaggcccccacaaagcagactcacaacattcc
acacctgtgccactgaacagggacagccctcggagcctgcatatgccttcccttcggccc
agtgatatagtccaggtctccttgaaattccagctgctcgacccgcccaacatgggccag
gacataaggtttgtcctgctggccctcaacatgtcactccagttcaaggacctcaaagtg
aacctgagtgcccagtccctgctgcatgatggcagccccctgccccctttctggcaggac
acagccttcatcacactttctcctgaagaagcaaagacccattcctgcagaattccctat
tcccagtatagccagtacctgtcaacagacaagctgatccgcatcagtgccctgggcgaa
gagaagaacagtccggaaaagattctggtggacaagatcatcaccttagcttatccaggc
atcatgattaatgttttaggagctgccattgtgaatcagccactctccatacaggtgctg
ttttcaaaccccctctcagagcatgttgcagattgtgtgctgactgtggaaggaagtggt
ctcttcaagaaacagcagagagttctcattggagtcctcaaacctcaacacagggccagc
atcaccctggagactgtccccttcaagagtggccaaaggcagatccaagctaatctgagg
agcaacaagtttaaggacatcaagggttacaagaatgtctatgtagacttgaggttataa

DBGET integrated database retrieval system