KEGG   Panthera tigris altaica (Amur tiger): 102967278
Entry
102967278         CDS       T02988                                 

Gene name
CCL2
Definition
(RefSeq) C-C motif chemokine 2
  KO
K14624  C-C motif chemokine 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
ptg04061  Viral protein interaction with cytokine and cytokine receptor
ptg04062  Chemokine signaling pathway
ptg04621  NOD-like receptor signaling pathway
ptg04657  IL-17 signaling pathway
ptg04668  TNF signaling pathway
ptg04933  AGE-RAGE signaling pathway in diabetic complications
ptg05135  Yersinia infection
ptg05142  Chagas disease
ptg05144  Malaria
ptg05163  Human cytomegalovirus infection
ptg05164  Influenza A
ptg05168  Herpes simplex virus 1 infection
ptg05171  Coronavirus disease - COVID-19
ptg05323  Rheumatoid arthritis
ptg05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    102967278 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102967278 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    102967278 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102967278 (CCL2)
   04657 IL-17 signaling pathway
    102967278 (CCL2)
   04062 Chemokine signaling pathway
    102967278 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    102967278 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102967278 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102967278 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102967278 (CCL2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    102967278 (CCL2)
   05164 Influenza A
    102967278 (CCL2)
   05168 Herpes simplex virus 1 infection
    102967278 (CCL2)
   05163 Human cytomegalovirus infection
    102967278 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    102967278 (CCL2)
   05142 Chagas disease
    102967278 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ptg04052]
    102967278 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:ptg00536]
    102967278 (CCL2)
Cytokines and growth factors [BR:ptg04052]
 Cytokines
  Chemokines
   102967278 (CCL2)
Glycosaminoglycan binding proteins [BR:ptg00536]
 Heparan sulfate / Heparin
  Chemokines
   102967278 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 102967278
NCBI-ProteinID: XP_007096128
LinkDB
Position
Un
AA seq 99 aa
MKVSAALLCLLLTAAAFSLQVLAQPDAINSPVTCCYTLTNKKISMQRLMSYKRVTSSKCP
KEAVIFKTILNKEICADPNQKWVKDSMAHLDKKTQTAKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcagcgcttctgtgcctgctgctcacagcagctgccttcagcctccag
gtgctcgcccagccagatgcaattaattctccagtcacctgttgctatacactcaccaat
aagaagatctcgatgcagaggctgatgagctataaaagagtcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccatcctaaacaaggagatctgcgctgacccaaaccag
aagtgggtcaaggattccatggcacacctggacaagaaaacccaaactgcaaagccttga

DBGET integrated database retrieval system